Protein Info for QEN71_RS21275 in Paraburkholderia sabiae LMG 24235

Annotation: 2-aminoethylphosphonate ABC transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 transmembrane" amino acids 38 to 57 (20 residues), see Phobius details amino acids 60 to 67 (8 residues), see Phobius details amino acids 91 to 115 (25 residues), see Phobius details amino acids 127 to 148 (22 residues), see Phobius details amino acids 168 to 190 (23 residues), see Phobius details amino acids 218 to 241 (24 residues), see Phobius details amino acids 248 to 268 (21 residues), see Phobius details amino acids 274 to 295 (22 residues), see Phobius details TIGR03226: 2-aminoethylphosphonate ABC transporter, permease protein" amino acids 12 to 302 (291 residues), 426.6 bits, see alignment E=3.3e-132 PF00528: BPD_transp_1" amino acids 103 to 302 (200 residues), 64.9 bits, see alignment E=4.3e-22

Best Hits

KEGG orthology group: K11083, 2-aminoethylphosphonate transport system permease protein (inferred from 96% identity to bph:Bphy_5067)

Predicted SEED Role

"2-aminoethylphosphonate ABC transporter permease protein I (TC 3.A.1.9.1)" in subsystem Phosphonate metabolism (TC 3.A.1.9.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (307 amino acids)

>QEN71_RS21275 2-aminoethylphosphonate ABC transporter permease subunit (Paraburkholderia sabiae LMG 24235)
MSSLSSPDSIAASRDAQRAATAASHAAAKRRRERLSQWHLLFLLVVVLGPLVIYPLIRLV
LLSLTGAHGLTFHAYAAFFQNPETSGVIGTTLWILFASAGLASILGVALASLLFFKPFPG
ARLVTRFLELFVAFPSFLVAFTLIFLYGSQGSVSIGLQRLFHLEAPPLDFLFGIGGVILA
EVVFYAPFVVRPTLASFALLDMRLIEAARSLGANSLMVAFRVILPLAWPGIAAGTILCFL
LTLNEFGILLVLGSAHLITLPVAIYSSATVDLDLPTAAAGAVVMLAMSLSLYALYRQVNR
RKVGGAK