Protein Info for QEN71_RS21140 in Paraburkholderia sabiae LMG 24235

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 transmembrane" amino acids 42 to 61 (20 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 97 to 117 (21 residues), see Phobius details amino acids 137 to 156 (20 residues), see Phobius details amino acids 162 to 184 (23 residues), see Phobius details amino acids 191 to 211 (21 residues), see Phobius details amino acids 223 to 242 (20 residues), see Phobius details PF03988: DUF347" amino acids 17 to 67 (51 residues), 67.1 bits, see alignment 6.6e-23 amino acids 72 to 121 (50 residues), 55.9 bits, see alignment 1.9e-19 amino acids 137 to 186 (50 residues), 58.5 bits, see alignment 3e-20 amino acids 192 to 239 (48 residues), 43.9 bits, see alignment 1.1e-15

Best Hits

KEGG orthology group: None (inferred from 92% identity to bph:Bphy_5041)

Predicted SEED Role

"INTEGRAL MEMBRANE PROTEIN (Rhomboid family)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (251 amino acids)

>QEN71_RS21140 hypothetical protein (Paraburkholderia sabiae LMG 24235)
MDKANQALTKVPEVTLAFWIIKIAATTLGETGGDAASMSMNLGYLISTLIFAVIFIVAVI
AQIRAERFNPVLYWVTIIATTTVGTTLADFADRSLGIGYAGGSALLLFLLFTSLFVWYRT
MGSVSVATVSSAKAEMFYWVTIMFSQTLGTALGDWTADTAGLGYAGAALIFGGLLLALVI
AYYATQLPRTLLFWAAFILTRPLGAVVGDFLDKPIANGGLAMSRYGASIALVAFIVVCGT
LFRQRPAKVSH