Protein Info for QEN71_RS21115 in Paraburkholderia sabiae LMG 24235

Annotation: sulfonate ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details TIGR01728: ABC transporter, substrate-binding protein, aliphatic sulfonates family" amino acids 42 to 319 (278 residues), 236.5 bits, see alignment E=1.9e-74 PF04069: OpuAC" amino acids 68 to 244 (177 residues), 33.8 bits, see alignment E=5.8e-12 PF13379: NMT1_2" amino acids 69 to 266 (198 residues), 31.5 bits, see alignment E=3.2e-11 PF09084: NMT1" amino acids 84 to 244 (161 residues), 57.3 bits, see alignment E=4.4e-19

Best Hits

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 88% identity to bge:BC1002_6606)

Predicted SEED Role

"Alkanesulfonates-binding protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization or Putative sulfate assimilation cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (325 amino acids)

>QEN71_RS21115 sulfonate ABC transporter substrate-binding protein (Paraburkholderia sabiae LMG 24235)
MSNVKTFHGRRTFLKQSLGITAAALSSAVVPASFAQGSARTLRIGNQKGYLNLLKGRGTL
EKRLAPLNVSVSWTEFAAGPVQLEALNVGSIDFGDVGEAPPIFAQAAGAPLTYVAATVKR
PQSEAVLVPPQSAIRSVADLKGKRIALNKGSNVHYFLVKLLRQHGLQYSDVHPVFLAPAD
ARAAFERASIDAWVIWDPFFAAAEKSLGARVIADASGVVGNRAYYFSSQTYAAKNPDVIR
ILIEELDKVDQWGKQNRDQLASELAQLWGLPKPVVDVVVARQQFGTEPITRAILAEQQQI
ADTFLDLGLIPKHIDVSKAAPPNLA