Protein Info for QEN71_RS20920 in Paraburkholderia sabiae LMG 24235

Annotation: paraquat-inducible protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 transmembrane" amino acids 42 to 67 (26 residues), see Phobius details amino acids 88 to 115 (28 residues), see Phobius details amino acids 132 to 154 (23 residues), see Phobius details amino acids 165 to 185 (21 residues), see Phobius details amino acids 240 to 260 (21 residues), see Phobius details amino acids 289 to 317 (29 residues), see Phobius details amino acids 338 to 358 (21 residues), see Phobius details amino acids 369 to 387 (19 residues), see Phobius details PF04403: PqiA" amino acids 41 to 194 (154 residues), 117.2 bits, see alignment E=3.2e-38 amino acids 242 to 395 (154 residues), 144.5 bits, see alignment E=1.2e-46

Best Hits

KEGG orthology group: K03808, paraquat-inducible protein A (inferred from 79% identity to bug:BC1001_4016)

Predicted SEED Role

"Paraquat-inducible protein A" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (401 amino acids)

>QEN71_RS20920 paraquat-inducible protein A (Paraburkholderia sabiae LMG 24235)
MTIGCPECGALDDVPPLAAHALARCRICHYPLERRSGRSVNAALACTTATFVLLLPANLA
PLMTVHMLGAQRSSLLSSGIVDMWRGGWLILALLLGAFGIVLPLLRFGGLALVLGAVRSG
RHFRGIGTLFRWTIWLDIWAMPDVYLVGCFVGYARVTQNLTGTIGPGGYCFIAAALMSML
TRAALDRRTVWRAIAPEHAPPADEPALSCTVCDRVEPASHEGQPCSRCGLTLRVRKPDAV
VRATALSLAALVLTVPANFYPMTLSMQLGRDVPHRIVDGVYQLFHAGLWPLGILIICTSI
VIPVGKLAGMAWFVASVMRRSRKHLRAKAHLYRWIDELGRWSNVDVFTIAAFVPLIHFDG
LASARPAPGATAFALVVFLTMLASRAFDPRMMWDARERRRS