Protein Info for QEN71_RS20855 in Paraburkholderia sabiae LMG 24235

Annotation: molybdopterin-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 PF00174: Oxidored_molyb" amino acids 103 to 247 (145 residues), 101.3 bits, see alignment E=2.4e-33

Best Hits

Swiss-Prot: 68% identical to YEDY1_AZOOP: Putative protein-methionine-sulfoxide reductase subunit YedZ1 (yedY1) from Azospira oryzae (strain ATCC BAA-33 / DSM 13638 / PS)

KEGG orthology group: K07147, (no description) (inferred from 95% identity to bph:Bphy_5020)

Predicted SEED Role

"COG2041: Sulfite oxidase and related enzymes"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (258 amino acids)

>QEN71_RS20855 molybdopterin-dependent oxidoreductase (Paraburkholderia sabiae LMG 24235)
MKNDAKPIVKLDRASILADASRELEMPSRRLFGKRMLTLGGLSLLTGCSITDDDSVNKFL
TAVSRLNDRAQAFLFDPNRLAPTYTEAQLTRPFPFNAFYGIDDVPDVNGSDYRLKVSGLV
TGQRVWTLPELYALPHAEQITRHICVEGWSAIGRWGGTPFAEFLRRIGADTTAKYVGFRC
ADDYYESIDMPTALHPQTLLTFEYDGERLPAKYGYPMKLRMPTKLGYKNPKHIVEIFVTN
TYPGGYWVDQGYNWFGGS