Protein Info for QEN71_RS20565 in Paraburkholderia sabiae LMG 24235

Annotation: divalent metal cation transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 547 transmembrane" amino acids 45 to 61 (17 residues), see Phobius details amino acids 78 to 96 (19 residues), see Phobius details amino acids 122 to 146 (25 residues), see Phobius details amino acids 152 to 172 (21 residues), see Phobius details amino acids 184 to 206 (23 residues), see Phobius details amino acids 226 to 245 (20 residues), see Phobius details amino acids 266 to 289 (24 residues), see Phobius details amino acids 318 to 343 (26 residues), see Phobius details amino acids 363 to 382 (20 residues), see Phobius details amino acids 392 to 411 (20 residues), see Phobius details amino acids 427 to 450 (24 residues), see Phobius details amino acids 456 to 478 (23 residues), see Phobius details amino acids 525 to 546 (22 residues), see Phobius details PF01566: Nramp" amino acids 69 to 424 (356 residues), 258.3 bits, see alignment E=5.8e-81

Best Hits

KEGG orthology group: None (inferred from 96% identity to bph:Bphy_4721)

Predicted SEED Role

"Manganese transport protein MntH" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (547 amino acids)

>QEN71_RS20565 divalent metal cation transporter (Paraburkholderia sabiae LMG 24235)
MATPPQALPTRSAVLDDAHVGDIRGALGTIAHHDTAPRNSWGARLRTLLAIVGPGLIVMV
GDNDAGAFGTYTQAGQNYGTTLLWTLLLLVPVLYVNQEMVLRLGAVTGVGHARLIFERFG
KFWGAFSVVDLFILNALTIVTEFIGITFVLDFFGVSKVAGVCIAAALTMAAVSTGDFKRF
ERFAIVLCLLSLLLVPVLVTIHPPVAQMTQHLFMPAWPAHAKLSDVMLLVIGIVGTTVAP
WQLFFQQSYVIDKRITPRFMKYEKADLWIGIVFVLIGAIAMISFSAALFGGKPEFGQFSD
AGGVIAGLEKYAGRTPAVLFAIALIDACIIGAAAVSLSTAYAIGDVFKIRHSLHRGVADA
KGFYLVYFGIVAAAAGLVLIPGSPLGLLTEAVQTLAGVLLPSATVFLLLLCNDREVLGPW
VNSKGLNLFTGAVVWALVLLSVVLTASVVYPDISGHAIIEILAGGTLLAVVAFVAATALR
RLRGASVADSMPVISKAERMTWRTPPLDTLPRPAMTLPRRIWMSALRGYLVVAVALVIVK
VVQLALA