Protein Info for QEN71_RS20170 in Paraburkholderia sabiae LMG 24235

Annotation: tetratricopeptide repeat-containing glycosyltransferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 520 PF13432: TPR_16" amino acids 15 to 73 (59 residues), 31.5 bits, see alignment 1.2e-10 amino acids 86 to 141 (56 residues), 19.1 bits, see alignment 9.6e-07 amino acids 113 to 173 (61 residues), 27 bits, see alignment E=3.2e-09 amino acids 145 to 208 (64 residues), 32.2 bits, see alignment E=7.4e-11 PF14559: TPR_19" amino acids 86 to 144 (59 residues), 32.6 bits, see alignment 5.3e-11 PF13174: TPR_6" amino acids 109 to 140 (32 residues), 18 bits, see alignment (E = 2.3e-06) PF13181: TPR_8" amino acids 141 to 173 (33 residues), 21.4 bits, see alignment (E = 1.3e-07) amino acids 175 to 207 (33 residues), 21.9 bits, see alignment (E = 9e-08) PF13414: TPR_11" amino acids 155 to 185 (31 residues), 27.3 bits, see alignment (E = 1.5e-09) PF13431: TPR_17" amino acids 163 to 196 (34 residues), 24.1 bits, see alignment (E = 1.9e-08) PF07719: TPR_2" amino acids 176 to 207 (32 residues), 25.2 bits, see alignment (E = 7.9e-09) PF13374: TPR_10" amino acids 176 to 204 (29 residues), 19.9 bits, see alignment (E = 3.9e-07) PF01075: Glyco_transf_9" amino acids 436 to 469 (34 residues), 30 bits, see alignment (E = 2.2e-10)

Best Hits

KEGG orthology group: None (inferred from 91% identity to bph:Bphy_4648)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (520 amino acids)

>QEN71_RS20170 tetratricopeptide repeat-containing glycosyltransferase family protein (Paraburkholderia sabiae LMG 24235)
MNHDIAQSLADAQQKFTAGQYDEAAALLNGILSVDPNHNEALEALGYVAAKQGDYARAAD
YAWRAAQPASTNPQQLHFAAHICQLAGRHADSLVLFERVLTAFPDHAESLHGAAMSLVAT
GEHARALQRLARLAQRYPQSAEVQYNRGTLLGQMERYDEELAAYRQAIALKPNFVRAYVN
LGVALRDLHRFDEALQQFKKAVSIDTNDAGARTNRAQTNLLLGEFEHGWREYEWRWLDGT
MSHGLPDATLWTGKQPLDGKTLLVHAEQGFGDTLQFIRFVGRLSAMGARVIVRVQDALLP
LLRGFPGTAEVIGETMPLPAFDYHIPMLSLAFALKVRETDLRIESPYVHADQQLAAQFAD
GFAQDDARPRVGIVWSGSRTHLNDRNRSIPLAQCMPLFDARAQFVSLVKDVREGDRAAVD
ELVARGVLRDVSDRLTSFAETAALVAQLDIVIAVDTAVAHLAAALGKPVWIALPFTPDWR
WQLKREDSPWYPQMRLFRQAKRNEWSDVVQQLRAALDAES