Protein Info for QEN71_RS20115 in Paraburkholderia sabiae LMG 24235

Annotation: Nramp family divalent metal transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 transmembrane" amino acids 66 to 91 (26 residues), see Phobius details amino acids 112 to 132 (21 residues), see Phobius details amino acids 135 to 161 (27 residues), see Phobius details amino acids 172 to 195 (24 residues), see Phobius details amino acids 215 to 234 (20 residues), see Phobius details amino acids 262 to 284 (23 residues), see Phobius details amino acids 299 to 320 (22 residues), see Phobius details amino acids 352 to 371 (20 residues), see Phobius details amino acids 377 to 397 (21 residues), see Phobius details amino acids 417 to 437 (21 residues), see Phobius details TIGR01197: metal ion transporter, metal ion (Mn2+/Fe2+) transporter (Nramp) family" amino acids 33 to 406 (374 residues), 353.4 bits, see alignment E=9.5e-110 PF01566: Nramp" amino acids 54 to 412 (359 residues), 441.5 bits, see alignment E=1.1e-136

Best Hits

Swiss-Prot: 73% identical to MNTH_RALSO: Divalent metal cation transporter MntH (mntH) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K03322, manganese transport protein (inferred from 96% identity to bph:Bphy_4637)

Predicted SEED Role

"Manganese transport protein MntH" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (442 amino acids)

>QEN71_RS20115 Nramp family divalent metal transporter (Paraburkholderia sabiae LMG 24235)
MQFKLPTTATAPFCPSEVQGTVTVSQSAPFWKKILQFAGPGLLVSIGYMDPGNWATDIEA
GSRYGYNLLFVVVLSSLAAMVLQCLSMRLGIVTGRNLAELSRTRYSPGVARFQWLLAELS
IVACDLAEVLGGALAFHLLFKCSLTVGVLLTAFDTLIVLGLKGKNFRDLEAIMLGLIATI
GIGYVIQLALVHPHWPSVAAGLVPSWQAISEREPLYLAIGILGATVMPHNLYLHSSVVQT
RAVKRDHQGIASAISLSRIDTVVALFLALLINAAILILAAAAFHSTGHTEVTEIEDAYRL
LAPIVGTGFAAVLFAITLLASGQSSTFTGTVAGQVIMEGFLQLKIPCYQRRFITRALALI
PALVGVQMLGNGAVGKLLVASQVVLSLQLPFALYPLIRMTGDRALMGEFANRLPTRILAW
ALFVLISAANIWLVVQTVGLAG