Protein Info for QEN71_RS20000 in Paraburkholderia sabiae LMG 24235

Annotation: phosphonate ABC transporter, permease protein PhnE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 69 to 93 (25 residues), see Phobius details amino acids 117 to 140 (24 residues), see Phobius details amino acids 176 to 194 (19 residues), see Phobius details amino acids 202 to 219 (18 residues), see Phobius details amino acids 229 to 249 (21 residues), see Phobius details TIGR01097: phosphonate ABC transporter, permease protein PhnE" amino acids 12 to 255 (244 residues), 305.7 bits, see alignment E=1.2e-95 PF00528: BPD_transp_1" amino acids 85 to 254 (170 residues), 75.4 bits, see alignment E=2.4e-25

Best Hits

Swiss-Prot: 69% identical to PHNE_ECOBD: Phosphonate transport system permease protein PhnE (phnE) from Escherichia coli (strain B / BL21-DE3)

KEGG orthology group: K02042, phosphonate transport system permease protein (inferred from 96% identity to bph:Bphy_4621)

Predicted SEED Role

"Phosphonate ABC transporter permease protein phnE (TC 3.A.1.9.1)" in subsystem ABC transporter alkylphosphonate (TC 3.A.1.9.1) (TC 3.A.1.9.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (256 amino acids)

>QEN71_RS20000 phosphonate ABC transporter, permease protein PhnE (Paraburkholderia sabiae LMG 24235)
MAAAAGKRSWVSLLGWIALIAVLGLSWRAADMRPLDLLSDSGNMGQFAKDFFPPDFTEWR
TYVHEMGVTLAVAVWGTALSIVCSIPFGLLSASNMAPAWVVQPVRRMMDACRAINEMVFA
MLFIVAVGLGPFAGVLALWVHTTGVLAKLFAEAVEAIDPRPAEGVRATGATSLDEIVYGV
LPQVMPLWISYALYRFESNVRSAMVVGMVGAGGIGVVLYESIRSFNYSQTAAVMLMVIVV
VTVIDVLSARLRERVI