Protein Info for QEN71_RS19675 in Paraburkholderia sabiae LMG 24235

Annotation: cyclopropane-fatty-acyl-phospholipid synthase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 PF02353: CMAS" amino acids 81 to 317 (237 residues), 137.1 bits, see alignment E=2.7e-43 PF05175: MTS" amino acids 114 to 195 (82 residues), 29.2 bits, see alignment E=2.3e-10 PF13489: Methyltransf_23" amino acids 118 to 261 (144 residues), 49.4 bits, see alignment E=1.6e-16 PF13847: Methyltransf_31" amino acids 133 to 245 (113 residues), 39.4 bits, see alignment E=1.9e-13 PF13649: Methyltransf_25" amino acids 138 to 237 (100 residues), 52.5 bits, see alignment E=2.3e-17 PF08242: Methyltransf_12" amino acids 139 to 239 (101 residues), 37.4 bits, see alignment E=1.3e-12 PF08241: Methyltransf_11" amino acids 139 to 241 (103 residues), 53.9 bits, see alignment E=8.1e-18

Best Hits

KEGG orthology group: K00574, cyclopropane-fatty-acyl-phospholipid synthase [EC: 2.1.1.79] (inferred from 70% identity to bpy:Bphyt_7082)

MetaCyc: 48% identical to phenylalkylamine N-methyltransferase (Ephedra sinica)
2.1.1.M76 [EC: 2.1.1.M76]; 2.1.1.M76 [EC: 2.1.1.M76]; 2.1.1.M76 [EC: 2.1.1.M76]; 2.1.1.M76 [EC: 2.1.1.M76]; 2.1.1.M76 [EC: 2.1.1.M76]

Predicted SEED Role

"Cyclopropane-fatty-acyl-phospholipid synthase-like protein, clusters with FIG005069"

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.79

Use Curated BLAST to search for 2.1.1.79 or 2.1.1.M76

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (365 amino acids)

>QEN71_RS19675 cyclopropane-fatty-acyl-phospholipid synthase family protein (Paraburkholderia sabiae LMG 24235)
MTFTATRPSIDTPKNACEDWLIHACERGWVPDRLIRIGMRRLMRQRLIEEGAFDYALRSK
RFSTLIDELRTSPVAIETDAANTQHYELPPSFFEAHLGPHLKYSCCLYPRGDETLDQAEH
AMLALYAERAQIEDGQTILDLGCGWGSLALWLAARYPLAQIVALSNSRGQREFIEARAAS
AGITNLRVITGNVVQFEFEQALRTGYFDRVLSVEMFEHMKNYGLLLERIARWMRPDGKLF
VHLFAHRTMAWHFQTRDATDWMSTYFFTGGTMPSEALLQHFQDDLRIDRQWWIGGAHYAR
TAEHWLANLDAARAQVMPELALAYGVDNAALWFQRWRMFYMSVAELFGYAKGNEWGVAHY
LFEKR