Protein Info for QEN71_RS19555 in Paraburkholderia sabiae LMG 24235

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 65 to 88 (24 residues), see Phobius details amino acids 96 to 121 (26 residues), see Phobius details amino acids 127 to 146 (20 residues), see Phobius details amino acids 187 to 210 (24 residues), see Phobius details amino acids 222 to 242 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 79 to 246 (168 residues), 109.5 bits, see alignment E=8.7e-36

Best Hits

Swiss-Prot: 36% identical to Y355_HAEIN: Probable ABC transporter permease protein HI_0355 (HI_0355) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 70% identity to vap:Vapar_1862)

Predicted SEED Role

"Hydroxymethylpyrimidine ABC transporter, transmembrane component" in subsystem Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (263 amino acids)

>QEN71_RS19555 ABC transporter permease (Paraburkholderia sabiae LMG 24235)
MNFTRKVLNSQWIRPLLLIVAILVAWDLVIRIFRIPPYLVPTPEAIMRQIAVQWPMLLQE
SLPTLYATLGGFALSVLIGVPIAMLVAASPLIESYLYPLVVFSQSIPKVAIAPLFVVWFG
FGLFPRVLVAFLLGFFPVVVSTVMGFKSVEKDLIDLAKSMGSSPVKTFFKISLPHALPSI
FSSMKVSITLAVVGAVVGEFVGANSGLGFVLQRANGNFDQPLIFSALVVLSVIGALLFVV
IDMLERVAIPWHASHRARALGRA