Protein Info for QEN71_RS19525 in Paraburkholderia sabiae LMG 24235

Annotation: dicarboxylate/amino acid:cation symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 44 to 65 (22 residues), see Phobius details amino acids 77 to 99 (23 residues), see Phobius details amino acids 148 to 167 (20 residues), see Phobius details amino acids 187 to 213 (27 residues), see Phobius details amino acids 224 to 247 (24 residues), see Phobius details amino acids 306 to 326 (21 residues), see Phobius details amino acids 345 to 375 (31 residues), see Phobius details amino acids 380 to 401 (22 residues), see Phobius details PF00375: SDF" amino acids 9 to 401 (393 residues), 354.7 bits, see alignment E=3.4e-110

Best Hits

Swiss-Prot: 71% identical to DCTA_CUPNJ: C4-dicarboxylate transport protein (dctA) from Cupriavidus necator (strain JMP 134 / LMG 1197)

KEGG orthology group: K11103, aerobic C4-dicarboxylate transport protein (inferred from 90% identity to bgf:BC1003_5361)

MetaCyc: 55% identical to C4 dicarboxylate/orotate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-121; TRANS-RXN-121A; TRANS-RXN-121C; TRANS-RXN-122A; TRANS-RXN0-451; TRANS-RXN0-517; TRANS-RXN0-553

Predicted SEED Role

"C4-dicarboxylate transport protein 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (420 amino acids)

>QEN71_RS19525 dicarboxylate/amino acid:cation symporter (Paraburkholderia sabiae LMG 24235)
MKKPFYRALYFQVFIAIFLGVLLGHFAPSLAVKMKPLGDAFIKLIKMVIGPIIFCTVVAG
IAGMGDMKKVGRVGGKALLYFEVVSTLSLVVGLVAGHLFHPGSGFNLDPAKIDTSALTGY
TAAAHQQNTVEFLMHVIPDTITGAFTSGNVLQILLVSVLFGAALAAAGERARPLVAMIDG
LTHTFFGIVHIIMKVAAIGAFGAIAFTIGTYGIGAVLPLLKLIGAFYLTLFVFVLVVLGM
ISRLLGFSILRFMSYIREEILIVLGTSSSEAALPQMLEKLERLGCSKSVVGLVIPAGYSF
NLDGTNIYLTMAVLFIAQAFNVELSLTQQLTLVGVAMLTSKGASGVAGAAFVMLTSTLLV
FPLIPVSGMVLILGIHRFMGTGLAIVNTIGNGVATLVVSAWEDELDRSRLNTEMLRRRSQ