Protein Info for QEN71_RS19420 in Paraburkholderia sabiae LMG 24235

Annotation: p-hydroxycinnamoyl CoA hydratase/lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 82% identical to HCHL_PSEFL: Hydroxycinnamoyl-CoA hydratase-lyase from Pseudomonas fluorescens

KEGG orthology group: K01692, enoyl-CoA hydratase [EC: 4.2.1.17] (inferred from 95% identity to bgf:BC1003_5483)

MetaCyc: 59% identical to feruloyl-CoA hydratase/lyase (Sphingomonas sp. SYK6)
4.1.2.41-RXN [EC: 4.1.2.61]; 4.1.2.61 [EC: 4.1.2.61]

Predicted SEED Role

"4-hydroxycinnamoyl CoA hydratase/lyase (Enoyl-CoA hydratase/lyase) (EC 4.2.1.17)" in subsystem Phenylpropanoid compound degradation (EC 4.2.1.17)

MetaCyc Pathways

oleate β-oxidation (28/35 steps found)
adipate degradation (5/5 steps found)
superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
benzoyl-CoA biosynthesis (3/3 steps found)
ferulate degradation (3/3 steps found)
phenylacetate degradation I (aerobic) (7/9 steps found)
4-hydroxybenzoate biosynthesis III (plants) (4/5 steps found)
adipate biosynthesis (4/5 steps found)
fatty acid β-oxidation IV (unsaturated, even number) (4/5 steps found)
superpathway of phenylethylamine degradation (8/11 steps found)
benzoyl-CoA degradation I (aerobic) (5/7 steps found)
fatty acid β-oxidation I (generic) (5/7 steps found)
fatty acid β-oxidation II (plant peroxisome) (3/5 steps found)
fatty acid β-oxidation VI (mammalian peroxisome) (4/7 steps found)
2-methyl-branched fatty acid β-oxidation (9/14 steps found)
3-phenylpropanoate degradation (6/10 steps found)
methyl ketone biosynthesis (engineered) (3/6 steps found)
benzoate biosynthesis I (CoA-dependent, β-oxidative) (5/9 steps found)
valproate β-oxidation (5/9 steps found)
4-coumarate degradation (aerobic) (2/5 steps found)
(8E,10E)-dodeca-8,10-dienol biosynthesis (6/11 steps found)
capsaicin biosynthesis (3/7 steps found)
benzoate biosynthesis III (CoA-dependent, non-β-oxidative) (1/5 steps found)
4-coumarate degradation (anaerobic) (1/6 steps found)
(4Z,7Z,10Z,13Z,16Z)-docosapentaenoate biosynthesis (6-desaturase) (2/13 steps found)
docosahexaenoate biosynthesis III (6-desaturase, mammals) (2/14 steps found)
Spodoptera littoralis pheromone biosynthesis (4/22 steps found)
platensimycin biosynthesis (6/26 steps found)
Amaryllidacea alkaloids biosynthesis (1/26 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.17

Use Curated BLAST to search for 4.1.2.61 or 4.2.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (278 amino acids)

>QEN71_RS19420 p-hydroxycinnamoyl CoA hydratase/lyase (Paraburkholderia sabiae LMG 24235)
MASYEDRWKTVDVKVEEGIAWVTFNRPEKRNAMSPTLNSEMVQVLETLELDADAQVLVLT
GAGDAWTAGMDLKEYFREVDAGPEILQEKIRRDACQWQWKLLRMYSKPTIAMVNGWCFGG
GFSPLVACDLAIAADEAVFGLSEINWGIPPGNLVSKAMADTVGHRQALYYIMTGETFTGT
EAAAMGLVNKSVPREQLRAETVALAAKLLEKNPVVLRVAKHGFKRCRELTWEQNEDYLYA
KLDQAQLRDPENGREEGLRQFLDQKSIKPGLQTYKRAD