Protein Info for QEN71_RS18585 in Paraburkholderia sabiae LMG 24235

Annotation: branched-chain amino acid ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF13458: Peripla_BP_6" amino acids 30 to 361 (332 residues), 193.3 bits, see alignment E=1.5e-60 PF01094: ANF_receptor" amino acids 52 to 228 (177 residues), 89.5 bits, see alignment E=3.3e-29 amino acids 295 to 368 (74 residues), 29 bits, see alignment E=8.7e-11 PF13433: Peripla_BP_5" amino acids 155 to 355 (201 residues), 29.1 bits, see alignment E=8.5e-11

Best Hits

KEGG orthology group: None (inferred from 96% identity to bug:BC1001_0631)

Predicted SEED Role

"Leucine-, isoleucine-, valine-, threonine-, and alanine-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (381 amino acids)

>QEN71_RS18585 branched-chain amino acid ABC transporter substrate-binding protein (Paraburkholderia sabiae LMG 24235)
MKSQLKPINAALTLACIVMAYGQAALADVTVKIGSAAPLTGNIAHMGQDAADGVKLAVQQ
INKAGNLVIGGQKVVLEVDSLDDQADPRTGTNVAQKLVDDGVVAVIGHLNSGVSIPASKI
YRDNGVTQITPGSTNPQYTLQGYKTAFRVIGTDAQQGPALAKYAQNQKVKTVVIVDDATA
YGQGLADQFEKTARAEGIQVLSREATNDKATDFKAILTKIKAERPDAIMYGGEDATGGPF
ARQAMQLAIRARILAGDGVCTTDLARLAGDAADNLVCSVAGGDLSAMAGSAAFGKELKAA
YGHDPVVYSPVAYSAVYVIVDAMKRSNSITRADILSAMPATNLNTLIGNIRFDEHGDLKD
SSISLYKYVKGKRTLLEVEKM