Protein Info for QEN71_RS18440 in Paraburkholderia sabiae LMG 24235

Annotation: selenocysteine-specific translation elongation factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 646 TIGR00475: selenocysteine-specific translation elongation factor" amino acids 1 to 631 (631 residues), 456.2 bits, see alignment E=9.4e-141 PF00009: GTP_EFTU" amino acids 2 to 133 (132 residues), 97.8 bits, see alignment E=1.5e-31 PF03144: GTP_EFTU_D2" amino acids 193 to 259 (67 residues), 44.4 bits, see alignment E=4.7e-15 PF09106: SelB-wing_2" amino acids 446 to 501 (56 residues), 61.7 bits, see alignment 1.5e-20 PF21214: bact_SelB_WH_2nd" amino acids 528 to 569 (42 residues), 43.6 bits, see alignment 5.6e-15 PF09107: SelB-wing_3" amino acids 587 to 630 (44 residues), 56.5 bits, see alignment 3.9e-19

Best Hits

KEGG orthology group: K03833, selenocysteine-specific elongation factor (inferred from 87% identity to bph:Bphy_4523)

Predicted SEED Role

"Selenocysteine-specific translation elongation factor" in subsystem Selenocysteine metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (646 amino acids)

>QEN71_RS18440 selenocysteine-specific translation elongation factor (Paraburkholderia sabiae LMG 24235)
MIVGTAGHIDHGKTTLVRALTGVDTDRLKEEKARGISIELGYAYTPLDNGDVLGMIDVPG
HEKLVHTMAAGACGIDYALLVIAADDGIMPQTREHLAILQLLGVTRGAIALTKTDRVDAA
RISLVRDEIRAWLAPTPFVEAPIFETNATASDDAGVRALSQHLRDAAVTWRARRDDGLFR
LAIDRVFTLTGQGTIVTGTVFAGRVATGDTLMLEPAQHPVRVRSIHAQNRAADVGRAGQR
CALNLAGIDKDAISRGDWIVDARLAQPGERLDVELTLLADADITLQHWAPLHVHIGTLHR
VAHVALLDGDTLAAGCSARVQLVFDAPVCAMPGDRFIVRNAQATRTVGGGRVLDPFGPPR
KRRTAERRAWLDALRTWLDEGRLAPLLDEAPRGVSRSMLMQLTGLPADALPLPADAESIP
LHGKDAGDAIVVLHKHWARLRSNVMAALDQYHARSPDEQGPDAARLRRIAAPLVPDAMWR
ALIDSLVNEGVIARSGPWLHLPGHSVALDSNEQRIADALLPLLVAGRFDPPWVRDLAKTT
GQQEEAVRQVLRKLARQGDVYQVVRDLFYSREVVHELARLIAGIADGHGGALGASAFRDA
TGLGRKRAIQILEFFDRIGYTRFQRDVHWLRPDSHLREALMCESDA