Protein Info for QEN71_RS18190 in Paraburkholderia sabiae LMG 24235

Annotation: SulP family inorganic anion transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 571 transmembrane" amino acids 50 to 74 (25 residues), see Phobius details amino acids 105 to 126 (22 residues), see Phobius details amino acids 138 to 157 (20 residues), see Phobius details amino acids 177 to 202 (26 residues), see Phobius details amino acids 214 to 240 (27 residues), see Phobius details amino acids 260 to 282 (23 residues), see Phobius details amino acids 294 to 314 (21 residues), see Phobius details amino acids 333 to 353 (21 residues), see Phobius details amino acids 360 to 381 (22 residues), see Phobius details amino acids 391 to 417 (27 residues), see Phobius details PF00916: Sulfate_transp" amino acids 28 to 395 (368 residues), 230.9 bits, see alignment E=2.2e-72 PF01740: STAS" amino acids 452 to 556 (105 residues), 44 bits, see alignment E=1.6e-15

Best Hits

KEGG orthology group: None (inferred from 91% identity to bph:Bphy_4477)

Predicted SEED Role

"Sulfate permease" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (571 amino acids)

>QEN71_RS18190 SulP family inorganic anion transporter (Paraburkholderia sabiae LMG 24235)
MQTPKDKPAARLSLLKGVLPFDRATAWRDVFSGISLASMDIPQVLGYARIAGMPAVTGLY
TVFLPLVAFAFFGASRHLVVAADSATATIFASRASTIAPMGSAEYVALAGMVALLTAALL
LLARIFKLGFLADFLSRTVLVGFLTGVGIQVSIAMLGDMFGMTVPYPSSRSLAQLAYVIG
HAAHAHLPTLALTALVVGAILVSKRFLPRVPTPLIAVAGSIAASKTYDFAAHGITVLGPI
SGGLPPLAFPSVTWQQFLDLVPVAASCFVMIIAQSAAAARVFAQQYHEEVDTNADILGLA
AANAAAAFSGTFVVNGSPTQTAMAERAGTRSQIGQLAFAVVVVVVLLFLSSYLQYLPHCV
LAAIVFTIAVGLINIPSLAAIRAESPGEFTLALITAAAVVMVGVEHGILLAVALSLLRHV
RHSYRPHTMVLEPSPPSGKWQPVPALPGIMTAPGLIVYRFGADLFFANDHLFCAEVVDLV
DAASGDLHSLVVDAAAITALDYSAARTLSDLIEDLHERKLAVIFGRVNPYLRSDMDRHGI
TQVIGQSNIFDTLHEALAAAGISPPHEVGAI