Protein Info for QEN71_RS17795 in Paraburkholderia sabiae LMG 24235

Annotation: TOBE domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 PF00126: HTH_1" amino acids 33 to 94 (62 residues), 36.8 bits, see alignment E=3e-13 TIGR00638: molybdenum-pterin binding domain" amino acids 134 to 202 (69 residues), 73 bits, see alignment E=8e-25 amino acids 208 to 274 (67 residues), 70.6 bits, see alignment E=4.3e-24 PF03459: TOBE" amino acids 136 to 199 (64 residues), 55.9 bits, see alignment E=4.1e-19 amino acids 210 to 272 (63 residues), 60.2 bits, see alignment E=1.8e-20

Best Hits

KEGG orthology group: K02019, molybdate transport system regulatory protein (inferred from 94% identity to bph:Bphy_4402)

Predicted SEED Role

"DNA-binding domain of ModE / Molybdate-binding domain of ModE" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (276 amino acids)

>QEN71_RS17795 TOBE domain-containing protein (Paraburkholderia sabiae LMG 24235)
MTSDNNDTSHDSLQFGGSVWFRSGEQALGGAQRIALLAAIGETGSITAGAKAVGMSYKAA
WDAVDAMNNLAGETLVVRSTGGKGGGGTTLTPRALTLIDTFRAVDREHRLFLERAGAAIA
GFSDDWQMIGRIGMKTSARNQLYGKVSAVQRGTVNDEISLALPGGQSIVAIVTHESTETL
GLAVGAEAVALVKASSVLLVADDGTSDRLSTRNRLKGTVSAVQRGAVNAEVSLTLEGGAV
LTSVVTNDSVAALGIAEGQALVAAFKASSVILGVTA