Protein Info for QEN71_RS17590 in Paraburkholderia sabiae LMG 24235

Annotation: succinate dehydrogenase iron-sulfur subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13085: Fer2_3
  • amino acids 5 to 109 (105 residues), 118.7 bits, E=3.5e-38
• TIGR00384: succinate dehydrogenase and fumarate reductase iron-sulfur protein
  • amino acids 8 to 226 (219 residues), 281.4 bits, E=2.2e-88
• PF13183: Fer4_8
  • amino acids 142 to 216 (75 residues), 39.6 bits, E=2e-13
• PF13534: Fer4_17
  • amino acids 144 to 217 (74 residues), 39.8 bits, E=1.6e-13
• PF13237: Fer4_10
  • amino acids 144 to 213 (70 residues), 42.5 bits, E=1.6e-14
• PF12838: Fer4_7
  • amino acids 145 to 215 (71 residues), 27.6 bits, E=1e-09

Best Hits

Swiss-Prot: 67% identical to SDHB_ECOLI: Succinate dehydrogenase iron-sulfur subunit (sdhB) from Escherichia coli (strain K12)

KEGG orthology group: K00240, succinate dehydrogenase iron-sulfur protein [EC: 1.3.99.1] (inferred from 97% identity to bxe:Bxe_B2892)

MetaCyc: 66% identical to succinate dehydrogenase iron-sulfur subunit (Pseudomonas putida KT2440)
Succinate dehydrogenase (ubiquinone). [EC: 1.3.5.1]

Predicted SEED Role

"Succinate dehydrogenase iron-sulfur protein (EC 1.3.99.1)" in subsystem Serine-glyoxylate cycle or Succinate dehydrogenase or TCA Cycle (EC 1.3.99.1)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• TCA cycle V (2-oxoglutarate synthase) (8/9 steps found)
• superpathway of glyoxylate bypass and TCA (10/12 steps found)
• partial TCA cycle (obligate autotrophs) (7/8 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (17/22 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
• aerobic respiration III (alternative oxidase pathway) (3/3 steps found)
• TCA cycle I (prokaryotic) (8/10 steps found)
• TCA cycle III (animals) (8/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (13/17 steps found)
• TCA cycle VIII (Chlamydia) (5/6 steps found)
• succinate to cytochrome bd oxidase electron transfer (2/2 steps found)
• succinate to cytochrome bo oxidase electron transfer (2/2 steps found)
• TCA cycle II (plants and fungi) (7/9 steps found)
• TCA cycle IV (2-oxoglutarate decarboxylase) (7/9 steps found)
• TCA cycle VII (acetate-producers) (7/9 steps found)
• mixed acid fermentation (12/16 steps found)
• aerobic respiration I (cytochrome c) (3/4 steps found)
• glycerol-3-phosphate to fumarate electron transfer (1/2 steps found)
• succinate to cytochrome aa₃ oxidase electron transfer (1/2 steps found)
• TCA cycle VI (Helicobacter) (6/9 steps found)
• methylaspartate cycle (13/19 steps found)
• aerobic respiration II (cytochrome c) (yeast) (2/4 steps found)
• succinate to chytochrome c oxidase via cytochrome c₆ (thylakoid membrane) (1/3 steps found)
• succinate to cytochrome c oxidase via plastocyanin (thylakoid membrane) (1/3 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (6/10 steps found)
• reductive TCA cycle I (6/11 steps found)
• incomplete reductive TCA cycle (3/7 steps found)
• pyruvate fermentation to propanoate I (3/7 steps found)
• reductive TCA cycle II (6/12 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (6/13 steps found)
• L-glutamate degradation VIII (to propanoate) (3/11 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (23/56 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Butanoate metabolism
• Citrate cycle (TCA cycle)
• Oxidative phosphorylation
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.1

Use Curated BLAST to search for 1.3.5.1 or 1.3.99.1

Protein Sequence (234 amino acids)

>QEN71_RS17590 succinate dehydrogenase iron-sulfur subunit (Paraburkholderia sabiae LMG 24235)
MAKRTFEIYRYDPDKDAAPRMQSYEIEIDSHERMLLDALVKLKALDETLSFRRSCREGVC
GSDAMNINGKNGLACLTNLNDLPQKIVLRPLPGLPVVRDLIVDMTQFFNQYHSIKPFLIN
DTPPPEKERLQSPEQRDELDGLYECILCASCSTSCPSFWWNPDKFVGPAGLLQAYRFIAD
SRDEATGERLDNLEDPYRLFRCHTIMNCVDVCPKGLNPTKAIGKIKELMVRRTV