Protein Info for QEN71_RS16450 in Paraburkholderia sabiae LMG 24235

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 TIGR00229: PAS domain S-box protein" amino acids 12 to 71 (60 residues), 23.8 bits, see alignment E=4e-09 PF00989: PAS" amino acids 12 to 59 (48 residues), 30.8 bits, see alignment 4e-11 PF08448: PAS_4" amino acids 14 to 131 (118 residues), 24.5 bits, see alignment E=4e-09 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 146 to 309 (164 residues), 175.7 bits, see alignment E=6.5e-56 PF00990: GGDEF" amino acids 150 to 307 (158 residues), 151.7 bits, see alignment E=2.4e-48

Best Hits

KEGG orthology group: None (inferred from 97% identity to bph:Bphy_4141)

Predicted SEED Role

"diguanylate cyclase (GGDEF domain) with PAS/PAC sensor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (312 amino acids)

>QEN71_RS16450 diguanylate cyclase (Paraburkholderia sabiae LMG 24235)
MNAPLPTLSDLVVERVGFGIFVLDRQMNVLMWNRFMQDHSGLSAQQVVGKSIFASFPELP
RVWLTRKLESVFQLGSFAFSSWEQRPYLFKFDHDRPITGGVDFMQQDCTFMPIMREREVE
AVCVTVSDVTDVSIMQREREEAVAKLQEYADRDGLTGIANRRYFEARLRDEYTRWQRYGG
ELSILLFDLDHFKKINDQFGHVVGDAVLREMAQRVAHVVRAQDTFGRFGGEEFALLLPCT
PLEDAMLVAEKIRHTIGDTPVDVQGVDVPVTASVGGAAARAGVPAYEALINEADAALYSA
KRQGRNRSVAFI