Protein Info for QEN71_RS16065 in Paraburkholderia sabiae LMG 24235

Annotation: acyl-CoA dehydrogenase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 PF02771: Acyl-CoA_dh_N" amino acids 18 to 128 (111 residues), 52.8 bits, see alignment E=9.8e-18 PF02770: Acyl-CoA_dh_M" amino acids 132 to 224 (93 residues), 77.7 bits, see alignment E=1.3e-25 PF00441: Acyl-CoA_dh_1" amino acids 237 to 385 (149 residues), 154.3 bits, see alignment E=5.4e-49 PF08028: Acyl-CoA_dh_2" amino acids 253 to 374 (122 residues), 90.5 bits, see alignment E=2.3e-29

Best Hits

Swiss-Prot: 39% identical to ACDS_MEGEL: Acyl-CoA dehydrogenase, short-chain specific from Megasphaera elsdenii

KEGG orthology group: None (inferred from 94% identity to bph:Bphy_4072)

MetaCyc: 39% identical to short-chain acyl-CoA dehydrogenase monomer (Pseudomonas putida KT2440)
RXN-13449 [EC: 1.3.8.1]

Predicted SEED Role

"Acyl-CoA dehydrogenase (EC 1.3.8.7)" (EC 1.3.8.7)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.3.8.7

Use Curated BLAST to search for 1.3.8.1 or 1.3.8.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (395 amino acids)

>QEN71_RS16065 acyl-CoA dehydrogenase family protein (Paraburkholderia sabiae LMG 24235)
MKHEDLHSALAWPFFEARHRELAGGIEAWAAQHLAHVKHDDTDATCRQLVRALGEAGWLK
YGVGGTQYGGHGDTIDTRAVCLLRETLAKHDGLADFALAMQGLGSGAITLAGTHEQKTRY
LPRVAKGEAIAAFALSEPDAGSDVAAMALQARAEGDFYVLDGDKTWISNGGIADFYVVFA
RTGEAPGSRGISAFIVDADTPGLQIAERIDVIAPHPLARLHFENARVPRSQMLGAPGEGF
KIAMRTLDIFRTSVAAASLGFARRAMQEGLERAASRKMFGQTLGDFQLTQTKLAQMALTI
DSSALLVYRAAWLRDQGESVTREAAMAKWHASEGAQQVIDSAVQLWGGMGVQSGTTVERL
YREIRALRIYEGATEVQQLIVGRDLLKAHATERAS