Protein Info for QEN71_RS16050 in Paraburkholderia sabiae LMG 24235

Annotation: SDR family NAD(P)-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 PF13241: NAD_binding_7" amino acids 5 to 98 (94 residues), 23.7 bits, see alignment E=1.5e-08 PF00106: adh_short" amino acids 8 to 197 (190 residues), 215.1 bits, see alignment E=1.7e-67 PF01370: Epimerase" amino acids 11 to 239 (229 residues), 30.5 bits, see alignment E=6.2e-11 PF08659: KR" amino acids 11 to 161 (151 residues), 56.7 bits, see alignment E=7.7e-19 PF13561: adh_short_C2" amino acids 17 to 256 (240 residues), 202.5 bits, see alignment E=2e-63

Best Hits

KEGG orthology group: None (inferred from 89% identity to bph:Bphy_4069)

Predicted SEED Role

"D-beta-hydroxybutyrate dehydrogenase (EC 1.1.1.30)" in subsystem Polyhydroxybutyrate metabolism (EC 1.1.1.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.30

Use Curated BLAST to search for 1.1.1.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (259 amino acids)

>QEN71_RS16050 SDR family NAD(P)-dependent oxidoreductase (Paraburkholderia sabiae LMG 24235)
MDTTLAGKHAVVTGGGSGIGAATAQALIRAGARVTLMGRDAKRLDAQRETLSAYGEIAAC
ISVDVSDESAVNKAFSEASSIAGAVDVLVNNAGQAQAAPFAQTDSALWQRMLDVNLTGVF
LCTRAVLPSMLERSYGRVINVASTAGQIGYAYVAAYCAAKHGVIGLTRSLALEVATKGIT
VNAVCPGYTETELLRASLDQITAKTSRSEQEARDILVRNNPQRRFVSPEEVANAVLWLCM
PGSESITGQSISVSGGEVT