Protein Info for QEN71_RS16030 in Paraburkholderia sabiae LMG 24235

Annotation: ribulose-bisphosphate carboxylase large subunit family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 PF02788: RuBisCO_large_N" amino acids 18 to 131 (114 residues), 30.8 bits, see alignment E=3.1e-11 PF00016: RuBisCO_large" amino acids 141 to 421 (281 residues), 253.5 bits, see alignment E=2.7e-79

Best Hits

Swiss-Prot: 48% identical to RBLL_BORBR: Uncharacterized ribulose bisphosphate carboxylase-like protein (BB1035) from Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)

KEGG orthology group: K01601, ribulose-bisphosphate carboxylase large chain [EC: 4.1.1.39] (inferred from 81% identity to bxe:Bxe_B0441)

MetaCyc: 46% identical to 3-oxoisoapionate-4-phosphate transcarboxylase/hydrolase (Xanthobacter autotrophicus Py2)
RXN-20936 [EC: 3.7.1.28]

Predicted SEED Role

"similar to ribulose-1,5-bisphosphate carboxylase, Type III"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.39

Use Curated BLAST to search for 3.7.1.28 or 4.1.1.39

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (425 amino acids)

>QEN71_RS16030 ribulose-bisphosphate carboxylase large subunit family protein (Paraburkholderia sabiae LMG 24235)
MNARDDSIEADYLIETPLDLAKVADTMAGEQSSGTFVRVANESDELRARSRANVLRIEEL
EPAPHASLPSAWLMRQRIDGPFRRARVTLSFPIANIGANLPTLAATVAGNLYDLGEVTGM
RLLSMRVPRAYRERFDMPVHGVAGTRRLTGVQNGPMVGTIIKPNVGLSAEETAQLVKTLC
EAGIDFIKDDEVCANPLHAPLDQRVRAVMREVRAFRERTGKRVMVAFNITDDVDAMRRHA
ELVEREEGDCVMASINWCGFSAIQALRRSTPLVLHAHRNGYGMMSRDAALGIGFQAYQTL
WRLAGVDHMHVHGLAGKFAQSDAEVSESARDCSTPLAEGLDDRVLPAFSSGQWAGTVPAT
FDAIGSTDLLFMSGGGVLAHPDGPAAGVRSVRQAWDAAQSRTPLHEHAKHAPELRAALAF
FGERT