Protein Info for QEN71_RS15675 in Paraburkholderia sabiae LMG 24235

Annotation: DHA2 family efflux MFS transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 519 signal peptide" amino acids 1 to 41 (41 residues), see Phobius details transmembrane" amino acids 57 to 77 (21 residues), see Phobius details amino acids 86 to 109 (24 residues), see Phobius details amino acids 115 to 135 (21 residues), see Phobius details amino acids 145 to 166 (22 residues), see Phobius details amino acids 172 to 194 (23 residues), see Phobius details amino acids 206 to 225 (20 residues), see Phobius details amino acids 237 to 258 (22 residues), see Phobius details amino acids 278 to 300 (23 residues), see Phobius details amino acids 311 to 329 (19 residues), see Phobius details amino acids 340 to 358 (19 residues), see Phobius details amino acids 371 to 394 (24 residues), see Phobius details amino acids 407 to 425 (19 residues), see Phobius details amino acids 485 to 502 (18 residues), see Phobius details TIGR00711: drug resistance MFS transporter, drug:H+ antiporter-2 (14 Spanner) (DHA2) family" amino acids 19 to 502 (484 residues), 475.2 bits, see alignment E=1.2e-146 PF06609: TRI12" amino acids 23 to 270 (248 residues), 31.7 bits, see alignment E=6e-12 PF07690: MFS_1" amino acids 24 to 417 (394 residues), 174.1 bits, see alignment E=3.9e-55

Best Hits

Swiss-Prot: 48% identical to EMRB_ECO57: Multidrug export protein EmrB (emrB) from Escherichia coli O157:H7

KEGG orthology group: K03446, MFS transporter, DHA2 family, multidrug resistance protein B (inferred from 94% identity to bph:Bphy_4020)

MetaCyc: 48% identical to multidrug efflux pump membrane subunit EmrB (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-363; TRANS-RXN-364; TRANS-RXN-365

Predicted SEED Role

"Inner membrane component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (519 amino acids)

>QEN71_RS15675 DHA2 family efflux MFS transporter permease subunit (Paraburkholderia sabiae LMG 24235)
MNPSTQTAPPPFTGGKLVLATLAVALATFMNVLDSSIANVAIPTISGNLGVSVDEGTWVI
TLFSAANAVAIPLTGWLTQRVGQIKLFVVSILLFVFSSWLCGVAPNLIVLLAARVLQGLV
AGPLTPLSQAILLASYPKEKSSTALSLWAMTATVGPIAGPALGGWITDSYSWSWIFYINI
PVGLFAAGVTWMLYRDRESQTRKLPIDKIGLLSLAMWVGTLQIMLDKGKDLDWFNSPVIW
ALTIVAAISFLFFLIWEFTEKNPIVDLRLFAGQNFRGGTIAISVAYAVFFANLVILPQWI
QGYLGYRSVDAGLVTAPLGVFAVLLAPVMAKIMPKSDARVLATLAFVGFAGVFIMRSHYT
TGVDQWTLILPTLLQGIPMALFFVPLTAIILSGLPAEKIPAAAGLSNFVRIFAGGVGTSL
ISTGWNNRTILHHAQLAEQSSATNPDYTGALTSIHAALGGSSDQAVAFFERSLNAQAAML
GLNDIFWLSSMIFIVIIPLIWLTKPSKGGGGSAAASGAH