Protein Info for QEN71_RS15330 in Paraburkholderia sabiae LMG 24235

Annotation: transcriptional repressor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF01475: FUR" amino acids 11 to 129 (119 residues), 105.9 bits, see alignment E=7.8e-35

Best Hits

Swiss-Prot: 39% identical to FUR_LEGPN: Ferric uptake regulation protein (fur) from Legionella pneumophila

KEGG orthology group: None (inferred from 93% identity to bph:Bphy_3966)

Predicted SEED Role

"Ferric uptake regulation protein FUR" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Iron acquisition in Vibrio or Oxidative stress or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (150 amino acids)

>QEN71_RS15330 transcriptional repressor (Paraburkholderia sabiae LMG 24235)
MIAIYAALKTAGLRPTSSRAAVLRLFHELPHEHFTADQVYRKLSREPEPCSLASVYRALA
QLHEADLITSASLGDARIVYELNRGQRHYHLVCSRCGRIQDAYDPGLEQQQARIAADHHF
HYTSSSLVIFGRCENCDALPAATTRRVGAS