Protein Info for QEN71_RS15300 in Paraburkholderia sabiae LMG 24235

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 transmembrane" amino acids 33 to 53 (21 residues), see Phobius details amino acids 100 to 117 (18 residues), see Phobius details amino acids 129 to 152 (24 residues), see Phobius details amino acids 158 to 177 (20 residues), see Phobius details amino acids 202 to 228 (27 residues), see Phobius details amino acids 249 to 273 (25 residues), see Phobius details PF00528: BPD_transp_1" amino acids 108 to 280 (173 residues), 93.7 bits, see alignment E=6.2e-31

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 100% identity to bph:Bphy_3961)

Predicted SEED Role

"ABC-type nitrate/sulfonate/bicarbonate transport system, permease component" in subsystem Alkanesulfonate assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (287 amino acids)

>QEN71_RS15300 ABC transporter permease (Paraburkholderia sabiae LMG 24235)
MSTTPQQMMPAGLDPTSLAQVERIAQKRIRQRNALVIGLRIAVLVLVLGGWEVSARMKWI
DPFFFSMPSLIFEQIVDWFVNGTSQGPLLTQVWVTLEETGLGFIIGSVAGVFCGIVLGRN
KLLSDVFSLYIKIANSIPRVVLGSVFVIALGLGMASKVALAVVMVFFVVFANAFQGVREA
DRYMIANAQILGASRRQVTTSVVIPSALSWILASLHVSFGFALVGAVVGEFLGSKQGIGL
LISTAQGAFNASGVFAAMIVLAVVALAADYLLTAVEQRLLKWRPNTN