Protein Info for QEN71_RS15245 in Paraburkholderia sabiae LMG 24235

Annotation: aromatic ring-hydroxylating dioxygenase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00355: Rieske
  • amino acids 43 to 122 (80 residues), 48.9 bits, E=5.1e-17
• PF00848: Ring_hydroxyl_A
  • amino acids 168 to 364 (197 residues), 132.9 bits, E=1.6e-42

Best Hits

KEGG orthology group: K00499, choline monooxygenase [EC: 1.14.15.7] (inferred from 98% identity to bph:Bphy_3951)

MetaCyc: 61% identical to putrescine 2-hydroxylase (Bordetella bronchiseptica)
1.14.13.M64 [EC: 1.14.13.M64]

Predicted SEED Role

"GbcA Glycine betaine demethylase subunit A" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis

MetaCyc Pathways

• glycine betaine biosynthesis III (plants) (3/3 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.M64 or 1.14.15.7

Protein Sequence (368 amino acids)

>QEN71_RS15245 aromatic ring-hydroxylating dioxygenase subunit alpha (Paraburkholderia sabiae LMG 24235)
MSNLSNALQLKAIHSQLPVTAYFDQALHQRELETLFKKGPRYVGHELMVPEAGNYFALPS
EREGRVLVRNQQSQIELLSNVCRHRQAIMLNGRGQTENIVCPLHRWTYDLNGQLLGAPHF
ADNPCLNLGATQLQSWNGLLFESQGRDVAKDLARLGTAKHFDFSDYMFDHVEVHECNYNW
KTFIEVYLEDYHVVPFHPGLGSFVNCDDLKWEFGDWYSVQTVGVHNELARPGSPTYRKWH
DEVLRYREGKMPEFGAIWMVYYPGIMIEWYPHVLVVSWLIPRGPQQTTNVVEFYYPEEIA
LFERDFVEAERAAYMETAREDDEIAERMDAGRRALLDRGESQVGPYQSPMEDGMQHFHEF
LRRELGTI