Protein Info for QEN71_RS15225 in Paraburkholderia sabiae LMG 24235

Annotation: GTP cyclohydrolase FolE2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 PF02649: GCHY-1" amino acids 10 to 259 (250 residues), 316.3 bits, see alignment E=8.6e-99 TIGR00294: GTP cyclohydrolase" amino acids 153 to 259 (107 residues), 101.1 bits, see alignment E=3.1e-33

Best Hits

Swiss-Prot: 95% identical to GCH4_PARP8: GTP cyclohydrolase FolE2 (folE2) from Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)

KEGG orthology group: K09007, hypothetical protein (inferred from 95% identity to bph:Bphy_3947)

Predicted SEED Role

"GTP cyclohydrolase I (EC 3.5.4.16) type 2" in subsystem Folate Biosynthesis or Queuosine-Archaeosine Biosynthesis (EC 3.5.4.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.4.16

Use Curated BLAST to search for 3.5.4.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (268 amino acids)

>QEN71_RS15225 GTP cyclohydrolase FolE2 (Paraburkholderia sabiae LMG 24235)
MNQMNPAFVMPDVQSTLDTRQIPIQRVGVKAVRHPLTVRTPDGNVQPTVGTWNLDVHLPA
EVKGTHMSRFVALLEENKAPLDSSVFRAMLASMLEKLEASAGRIEVSFPYFVNKTAPVSG
VQSLLDYEVTLMADSRDGATRLFLKVLVPVTSLCPCSKKISQYGAHNQRSHVTIKAELID
DVPVEDLIRIAEEEASCELWGLLKRPDEKFVTERAYENPKFVEDLVRDVAQRLNSDQRIV
AYVLEAENFESIHNHSAYAVVERDKRSV