Protein Info for QEN71_RS14800 in Paraburkholderia sabiae LMG 24235

Annotation: amino acid carrier protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 529 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 37 to 57 (21 residues), see Phobius details amino acids 81 to 99 (19 residues), see Phobius details amino acids 119 to 139 (21 residues), see Phobius details amino acids 167 to 184 (18 residues), see Phobius details amino acids 213 to 233 (21 residues), see Phobius details amino acids 243 to 266 (24 residues), see Phobius details amino acids 273 to 293 (21 residues), see Phobius details amino acids 333 to 354 (22 residues), see Phobius details amino acids 388 to 412 (25 residues), see Phobius details amino acids 429 to 450 (22 residues), see Phobius details amino acids 462 to 482 (21 residues), see Phobius details TIGR00835: amino acid carrier protein" amino acids 44 to 482 (439 residues), 309.7 bits, see alignment E=1.5e-96 PF01235: Na_Ala_symp" amino acids 77 to 492 (416 residues), 323.5 bits, see alignment E=1.3e-100

Best Hits

KEGG orthology group: K03310, alanine or glycine:cation symporter, AGCS family (inferred from 60% identity to str:Sterm_2968)

Predicted SEED Role

"Sodium/glycine symporter GlyP" in subsystem Glycine cleavage system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (529 amino acids)

>QEN71_RS14800 amino acid carrier protein (Paraburkholderia sabiae LMG 24235)
MENLFRSVNAFFAFIAPISDLLWDFPTNFAAYARIPVLGQFPFAILLLVGVGIYFSIRTR
FVQTMNIGSIVRIMLRRQSSNTGVSALASFMLGLAMRAGPGNIVGITGAISVGGPGALFW
MWVAAFFGMATAFMESVLAQLFKEKKHDEFVGGLPFYGRRILGDRRIAGTFLSLVFIVYA
LFNVPPQTFNIFTALGTIADTVAGTHLARQSTVYYVIAASLVVACSFIIMGGIRRVTAYT
DVLVPIKATLFCLMSLVIILINLPLIPYFFHEVIVGAFAPHALFGGAIGTALAQGVKRGL
MSNEAGQGTITMAAAIADNDHPCEQGFVQSLGVFFDTMVICTMTGFIVVMAHVWTGTIDG
QAWESVRASKITVYLASVQTLVPASLAHVVKIVMCVCYGLFAFTTLLGMISFAEISANFI
SRSHTFITGIRVAGSLVFVPFGALTVLAGLELPNLWALSDLMNIVMVLLNVPIVLLGQGL
VYKALAHYRTKRGGPFVSEQIGVRTEYWTAGQRIAVQQAVDAPKERVET