Protein Info for QEN71_RS14705 in Paraburkholderia sabiae LMG 24235

Annotation: cyclodeaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 TIGR02992: ectoine utilization protein EutC" amino acids 4 to 327 (324 residues), 513.4 bits, see alignment E=1.2e-158 PF02423: OCD_Mu_crystall" amino acids 19 to 319 (301 residues), 197.3 bits, see alignment E=3.2e-62 PF01488: Shikimate_DH" amino acids 124 to 220 (97 residues), 46.5 bits, see alignment E=4.1e-16

Best Hits

Swiss-Prot: 61% identical to Y0419_RHIME: Putative dehydrogenase RB0419 (eutC) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K01750, ornithine cyclodeaminase [EC: 4.3.1.12] (inferred from 91% identity to bph:Bphy_3863)

Predicted SEED Role

"Ornithine cyclodeaminase (EC 4.3.1.12)" in subsystem Arginine and Ornithine Degradation (EC 4.3.1.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.3.1.12

Use Curated BLAST to search for 4.3.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (333 amino acids)

>QEN71_RS14705 cyclodeaminase (Paraburkholderia sabiae LMG 24235)
MTAITLLGEAQLRELVPLDLPAIDQVEAAFLSLATEAVAMPPILRLDLPEHRGEVDVKTA
YLPRFDSFAIKVSPGFFDNPKLGLPSLNGLMLVLSAKTGLTEAVLLDNGYLTAVRTAAAG
AVAARWLAKQHAPKVAVIGAGEQARLQLRALSMVRKVEHMTVWARNRVNAEQFAADMSAQ
LRITCEVARDVHHALAEADIAITTTPSTEPLIQAADLHPGLHITAMGSDAEHKNEIAPQA
LAATRYVCDRVTQTRVLGELHHAIEAGLVDAHAPHAELGQIIAGQAKGRTSDSDITLCDL
TGTGAQDTAIATLAVARARAADAGTIFRNDMKR