Protein Info for QEN71_RS14695 in Paraburkholderia sabiae LMG 24235

Annotation: N(2)-acetyl-L-2,4-diaminobutanoate deacetylase DoeB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 TIGR02994: ectoine utilization protein EutE" amino acids 2 to 330 (329 residues), 558.3 bits, see alignment E=2.3e-172 PF04952: AstE_AspA" amino acids 47 to 330 (284 residues), 235.9 bits, see alignment E=3e-74

Best Hits

Swiss-Prot: 65% identical to DOEB_HALED: N-alpha-acetyl-L-2,4-diaminobutyric acid deacetylase (doeB) from Halomonas elongata (strain ATCC 33173 / DSM 2581 / NBRC 15536 / NCIMB 2198 / 1H9)

KEGG orthology group: K06987, (no description) (inferred from 91% identity to bph:Bphy_3861)

MetaCyc: 65% identical to N2-acetyl-L-2,4-diaminobutanoate deacetylase (Halomonas elongata DSM 2581)
RXN-18396 [EC: 3.5.1.125]

Predicted SEED Role

"succinate dehydrogenase subunit"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.125

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (346 amino acids)

>QEN71_RS14695 N(2)-acetyl-L-2,4-diaminobutanoate deacetylase DoeB (Paraburkholderia sabiae LMG 24235)
MRASPISATVDFNADGEQHGFLKLPYSHDASAWGAVMIPITVIRNGDGPTALLTGGNHGD
EYEGPIVLSKLASTLKTSDVKGRVIIVPFMNYPAFRAGSRTSPIDRGNLNRAFPGKPDGT
VTEKIADYFQRYLLPLADYVLDLHAGGRTLDFVPFAAVHVLSDANQQARCEAAMRAFGAP
YSMRMLELDSVGLFDTAVEEAGKVFVSTELGGGGTATVESVAVAERGVRGFLANSGVLTV
RDDLSAESRTTVLLDMPDGSCYTTSEHDGLLELCKDLGDNVEAGEVIARVHDMSRTGMQP
IEYRAKRSGLLAARHFPGLVHIGDTVAVVADIVERGIPVVASAVKH