Protein Info for QEN71_RS14680 in Paraburkholderia sabiae LMG 24235

Annotation: aspartate aminotransferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 PF00202: Aminotran_3" amino acids 33 to 448 (416 residues), 271.7 bits, see alignment E=4.5e-85

Best Hits

Swiss-Prot: 63% identical to DOED_HALED: Diaminobutyrate--2-oxoglutarate transaminase (doeD) from Halomonas elongata (strain ATCC 33173 / DSM 2581 / NBRC 15536 / NCIMB 2198 / 1H9)

KEGG orthology group: None (inferred from 97% identity to bph:Bphy_3858)

MetaCyc: 63% identical to diaminobutanoate--2-oxoglutarate transaminase (Halomonas elongata DSM 2581)

Predicted SEED Role

"Gamma-aminobutyrate:alpha-ketoglutarate aminotransferase (EC 2.6.1.19)" (EC 2.6.1.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.19

Use Curated BLAST to search for 2.6.1.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (465 amino acids)

>QEN71_RS14680 aspartate aminotransferase family protein (Paraburkholderia sabiae LMG 24235)
MTQLDQLFSADRAHFMHPSTHAHDHASGALPGRIVTGANGIRIEDHQGKSFIDAFAGLYC
VNIGYGRTEVADAIYEQAKKLAYYHTYVGHSTDTIIELSSRIIDWAPKGMKKVYYGLSGS
DANETQIKIVWYYNNVKGRPNKKKIISRQRGYHGSGIVTGSLTGLPSFHQHFDLPIDRVK
HTVCPHWYRQAPAGMNEAQFVDYCVEELEKLIAKEGADTIAAFIGEPVMGTGGILPPPAG
YWPAIQKVLKKHDILLISDEVVCGFGRLGSKMGAQHFGIEPDLITVAKGLTSAYAPLSAV
IVGEKVWDVIEKGSQEHGPMGHGWTYSGHPVCAAAALANLDILERENLTQNAADVGGYLL
QRLHAAFDSHPLVGEVRGAGMLAALEFMANKDERRPFDAALKVGPRVSAAALQRGLIARA
MPHGDILGFAPPLVTTRDEVDEIVKLAKAAVDEVASQVLKESTTA