Protein Info for QEN71_RS14650 in Paraburkholderia sabiae LMG 24235

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 47 to 61 (15 residues), see Phobius details amino acids 84 to 109 (26 residues), see Phobius details amino acids 121 to 144 (24 residues), see Phobius details amino acids 149 to 173 (25 residues), see Phobius details PF05230: MASE2" amino acids 18 to 106 (89 residues), 97.4 bits, see alignment E=4e-32 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 184 to 347 (164 residues), 163.4 bits, see alignment E=1.9e-52 PF00990: GGDEF" amino acids 190 to 344 (155 residues), 147.2 bits, see alignment E=3.7e-47

Best Hits

KEGG orthology group: None (inferred from 93% identity to bph:Bphy_3853)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (359 amino acids)

>QEN71_RS14650 diguanylate cyclase (Paraburkholderia sabiae LMG 24235)
MKLATKSRAGQGKSFVERIYRLRIAGLGLGFFCVASVFALQQRGYVLWSLLVFHGFVWPH
VARRAALACEVPFRGERLNLMVDAMFGGFWVVAMRFNVLPSVLILAMLSMNNIGAGGLQT
FARGLIAHVLGVLVGLVTVGFVFSPMSQMPTILACLPFLIIYPLALGLTSYRLSLKLAQR
TRELEHLSRTDGLTRLWNRRHWEGLLAEEFERCRANRYASCLMLIDLDHFKRINDTMGHP
AGDAVLQSFADLLRSHFRAGDGIGRYGGEEFGVVLPGATLREAHTVAKVLVQRVREKTKE
ASKECPCTISVGIAQLTDNLPDYHTWLQEVDRSLYQAKATGRDRIVVGGLAPVQEAVRG