Protein Info for QEN71_RS14370 in Paraburkholderia sabiae LMG 24235

Annotation: vWA domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 50 to 69 (20 residues), see Phobius details amino acids 307 to 326 (20 residues), see Phobius details PF13519: VWA_2" amino acids 86 to 205 (120 residues), 53.3 bits, see alignment E=4e-18 PF00092: VWA" amino acids 86 to 227 (142 residues), 25.1 bits, see alignment E=1.9e-09

Best Hits

KEGG orthology group: None (inferred from 96% identity to bph:Bphy_3804)

Predicted SEED Role

"FIG00808917: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (332 amino acids)

>QEN71_RS14370 vWA domain-containing protein (Paraburkholderia sabiae LMG 24235)
MSTPPDFLYPWALVLLPLAALPLLRRSIDTLPYSWVAWLPRDRAGRVVAIIWRAAAVIAL
AAVIVGLAGPGFSGEQTRITGTGAEILILMDGSGSMNQAISSGSMNVADAPTAGETKNQM
ARDAITAFVAQRANDRLAFMLFGTHPMLAVPFTRDRTVIDAAIAATGVGRGTPDTLLDRG
IQSAVELFDGRPRTSSRAIVLVSDGGARLDDVAREHIRAGLARNGVALYFIYLRSGIYSP
DLHVRLVDADHSPEAELHRFFLSLPTAYRLYQADSPQQVARAMSDIARTENAPVSFIERL
PRQDRSAWCYATALFCCALLVGVWFMQRRSLR