Protein Info for QEN71_RS14355 in Paraburkholderia sabiae LMG 24235

Annotation: MoxR family ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 PF07726: AAA_3" amino acids 44 to 177 (134 residues), 90.3 bits, see alignment E=1.9e-29 PF07728: AAA_5" amino acids 44 to 175 (132 residues), 54.3 bits, see alignment E=3e-18 PF17863: AAA_lid_2" amino acids 265 to 329 (65 residues), 56.4 bits, see alignment E=4.1e-19

Best Hits

Swiss-Prot: 57% identical to MOXR_METEA: Protein MoxR (moxR) from Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / JCM 2805 / NCIMB 9133 / AM1)

KEGG orthology group: None (inferred from 95% identity to bph:Bphy_3801)

Predicted SEED Role

"MoxR-like ATPases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (339 amino acids)

>QEN71_RS14355 MoxR family ATPase (Paraburkholderia sabiae LMG 24235)
MDREELLEDWRTLALDIEHQVENAVIGQPDTIRLINVALFARGHVLLEGGVGVGKTTILR
AFARAIGGDFERVEGTIDLMPGDLVYHTYVDAEGRPRIEPGPLIKHGERLATFFFNEINR
ARPQVQSLLLRAMAERSVFAFDREYRFPHMTVFADRNKVEKEETFELAAAARDRFMFELN
MSTPDDAPARRALVFDPDFHDTDALLARVTPDVLPWQRLNTIAASIQRTIHASEAIERYA
LDIWRATENPAQFDIALDDVDMQRLILAGASPRGMSALLRAARVVAWLDGRTYLTPEDIH
GVLLPTLGHRVYFTPIYELRRQQLADALMEQIVSRVAAP