Protein Info for QEN71_RS14160 in Paraburkholderia sabiae LMG 24235

Annotation: amino acid permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 49 to 70 (22 residues), see Phobius details amino acids 90 to 119 (30 residues), see Phobius details amino acids 126 to 147 (22 residues), see Phobius details amino acids 155 to 175 (21 residues), see Phobius details amino acids 188 to 209 (22 residues), see Phobius details amino acids 225 to 252 (28 residues), see Phobius details amino acids 272 to 294 (23 residues), see Phobius details amino acids 326 to 345 (20 residues), see Phobius details amino acids 351 to 373 (23 residues), see Phobius details amino acids 385 to 414 (30 residues), see Phobius details PF13520: AA_permease_2" amino acids 14 to 396 (383 residues), 145.6 bits, see alignment E=3.4e-46 PF03845: Spore_permease" amino acids 14 to 250 (237 residues), 38.2 bits, see alignment E=1.2e-13 PF00324: AA_permease" amino acids 24 to 352 (329 residues), 77.3 bits, see alignment E=1.6e-25

Best Hits

KEGG orthology group: K03294, basic amino acid/polyamine antiporter, APA family (inferred from 92% identity to bph:Bphy_3765)

Predicted SEED Role

"Amino acid permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (429 amino acids)

>QEN71_RS14160 amino acid permease (Paraburkholderia sabiae LMG 24235)
MSTSTAMPRHSGSLSVMQGAALYVGAVLGTGVIALPALAAEAAGPASLVAWLALVLLSAP
LAATFAALGARYPDAGGVSTYVRNAFGPRAAAIVGWCFYFAVPAGAPAAAMFGGAYVAAA
FGGGEWTVIGTAAALILTVTLSNALGLTVSGRLQLVLAALLVALLLAAVIASAPHAQMEN
LRPFAPHGWLAVFPAAALLVWSFAGWEAITHLAAEFRRPAHDLPLAAGIAVVVVGVLYMG
VATMSVMVLGPAAGTSSAPLAELLARGLGGKVHMLAAVAALLLTLGTMNAYFAGAAKLGA
ALGRDGALPQWLAQGSRAGDVPRRSLFVIAGLATFALVVVVMAGVGPKPLVLLTTGSFVT
VYALGTAAALRLLPRGSWPHRCARVALVAVAGLCCATGWYLLWPLAVTGCALLYLRVRRV
FVSRARAIP