Protein Info for QEN71_RS13705 in Paraburkholderia sabiae LMG 24235

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 transmembrane" amino acids 24 to 44 (21 residues), see Phobius details amino acids 62 to 85 (24 residues), see Phobius details amino acids 92 to 111 (20 residues), see Phobius details amino acids 122 to 142 (21 residues), see Phobius details amino acids 154 to 177 (24 residues), see Phobius details amino acids 183 to 202 (20 residues), see Phobius details amino acids 228 to 247 (20 residues), see Phobius details amino acids 256 to 277 (22 residues), see Phobius details amino acids 289 to 306 (18 residues), see Phobius details amino acids 312 to 335 (24 residues), see Phobius details amino acids 347 to 366 (20 residues), see Phobius details amino acids 378 to 395 (18 residues), see Phobius details PF07690: MFS_1" amino acids 32 to 361 (330 residues), 115.7 bits, see alignment E=1.2e-37

Best Hits

Swiss-Prot: 33% identical to SOTB_PSEU2: Probable sugar efflux transporter (sotB) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: None (inferred from 91% identity to bph:Bphy_3714)

Predicted SEED Role

"Sugar efflux transporter B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (418 amino acids)

>QEN71_RS13705 MFS transporter (Paraburkholderia sabiae LMG 24235)
MNFENSPSSNLQDAADGASSPLRAWLAVASVTVGAFAFVTTEFLPVGLLPQVAQTFDVLP
GTAGLMVTIPGIMAAISAPGMMLAAGRVNRRLILILLSVMLLASNLLSAFAPSFPVMLVG
RAMLGGALGGFWTLALAAAGRLVKAHEAPRATAMILAGVTCATVIGVPLGTFIAGFASWR
MSFIATAVLVAVALIAQFALLPSLPSKAALRFADLVTLVRRPFPRKSLLMVALIFGAHFS
SYTYIAPFLQDAHFSASTITAVLLGFGIIGFVSNFAVSTFVARKLKGTLAAMTLLLLFAL
LTMPLLKDMAPVVTGVVLMWGVAFGAIPLCVSVWMQEAAPDLPEAGSALFVGIIQVAIAV
GSSAGGTIVDHAGIPVDFWFGSVLAILGLITLASFRTVRQNAQTNTPVKAGEVQTECV