Protein Info for QEN71_RS13520 in Paraburkholderia sabiae LMG 24235

Annotation: acyl-CoA dehydrogenase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02771: Acyl-CoA_dh_N
  • amino acids 9 to 117 (109 residues), 105.2 bits, E=5.5e-34
• PF02770: Acyl-CoA_dh_M
  • amino acids 121 to 217 (97 residues), 105.2 bits, E=3.2e-34
• PF00441: Acyl-CoA_dh_1
  • amino acids 231 to 378 (148 residues), 174.7 bits, E=2.8e-55
• PF08028: Acyl-CoA_dh_2
  • amino acids 246 to 367 (122 residues), 96.5 bits, E=3.2e-31

Best Hits

Swiss-Prot: 42% identical to CARC_ACEWD: Caffeyl-CoA reductase-Etf complex subunit CarC (carC) from Acetobacterium woodii (strain ATCC 29683 / DSM 1030 / JCM 2381 / KCTC 1655 / WB1)

KEGG orthology group: K06446, acyl-CoA dehydrogenase [EC: 1.3.99.-] (inferred from 97% identity to bph:Bphy_3683)

MetaCyc: 66% identical to medium-chain acyl-CoA dehydrogenase (Cupriavidus necator H16)
RXN-22997 [EC: 1.3.8.7]

Predicted SEED Role

No annotation

MetaCyc Pathways

• oleate β-oxidation (28/35 steps found)
• adipate degradation (5/5 steps found)
• fatty acid salvage (5/6 steps found)
• 2-methyl-branched fatty acid β-oxidation (9/14 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Brassinosteroid biosynthesis
• Caprolactam degradation
• Fatty acid metabolism
• Geraniol degradation
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 1.3.8.7, 1.3.99.-

Use Curated BLAST to search for 1.3.8.7 or 1.3.99.-

Protein Sequence (384 amino acids)

>QEN71_RS13520 acyl-CoA dehydrogenase family protein (Paraburkholderia sabiae LMG 24235)
MIRDQETLSILLDSLSRFVRERLVPAENEVAETDEIPAEIVGEMRELGLFGLSIPEEYGG
LGLTMEEEVLAAFEIAKTSPAFRSLIGTNNGIGSQGLIIDGTDEQKQYYLPKLASGELIA
SFALTEPGSGSDAASLRTTAMRDGDHYVINGTKRFITNAPEAGIYTVMARTNPDIKGASG
ISAFIVEKGTPGLSLGKIDKKMGQKGAHTCDVIFENCRVPASNIIGGKEGVGFKTAMKVL
DKGRLHISAICVGAAERMLDDALRYAMERKQFGQPIAEFQLVQAMLADSRAEIYAARSMV
LDAARRRDDKQDVSTEASCCKLFASEMCGRVADRAVQIHGGAGYVSDYAVERFYRDVRLF
RIYEGTTQIQQLVIARNMIRDASR