Protein Info for QEN71_RS13340 in Paraburkholderia sabiae LMG 24235

Annotation: ubiquinol oxidase subunit II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01433: ubiquinol oxidase, subunit II
  • amino acids 18 to 238 (221 residues), 378.3 bits, E=5.3e-118
• PF00116: COX2
  • amino acids 151 to 219 (69 residues), 29.2 bits, E=7.4e-11
• PF06481: COX_ARM
  • amino acids 238 to 283 (46 residues), 72.7 bits, 1.8e-24

Best Hits

Swiss-Prot: 65% identical to QOX2_ACEAC: Ubiquinol oxidase subunit 2 (cyaB) from Acetobacter aceti

KEGG orthology group: K02297, cytochrome o ubiquinol oxidase subunit II [EC: 1.10.3.-] (inferred from 95% identity to bph:Bphy_3649)

MetaCyc: 59% identical to cytochrome bo terminal oxidase subunit II (Pseudomonas putida KT2440)
RXN0-5268 [EC: 7.1.1.3]

Predicted SEED Role

"Cytochrome O ubiquinol oxidase subunit II (EC 1.10.3.-)" in subsystem Terminal cytochrome O ubiquinol oxidase or Terminal cytochrome oxidases (EC 1.10.3.-)

MetaCyc Pathways

• NADH to cytochrome bo oxidase electron transfer I (2/2 steps found)
• glycerol-3-phosphate to cytochrome bo oxidase electron transfer (2/2 steps found)
• pyruvate to cytochrome bo oxidase electron transfer (2/2 steps found)
• succinate to cytochrome bo oxidase electron transfer (2/2 steps found)
• D-lactate to cytochrome bo oxidase electron transfer (1/2 steps found)
• NADH to cytochrome bo oxidase electron transfer II (1/2 steps found)
• proline to cytochrome bo oxidase electron transfer (1/2 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 7.1.1.3

Protein Sequence (299 amino acids)

>QEN71_RS13340 ubiquinol oxidase subunit II (Paraburkholderia sabiae LMG 24235)
MLARKTLRGCLVPVSVGLTACLAGCQLEVLDPKGSVGVAEKSLIATATWTMLIVVVPVIL
LTLFFAWRYRASNKSAVYAPKWAHSTAIEVVVWTIPALIILFLGILTWRTTHELDPYKPL
ESNVKPIDVEVVALDWKWLFIYPDLGIASVNQLAMPVGTPVNFHITSDSVMNSFFIPQLG
TQVYAMAGMQTRVHLIADHAGDYAGVSANFSGKGFSDMKFRTLAVSQADFDGWVQKAKAS
SDRLDMDGYYAVAKPSEKNPVRYFSSVDPKLFHNVIAKYNSGHVVDFRDANCSTNASKE