Protein Info for QEN71_RS13335 in Paraburkholderia sabiae LMG 24235

Annotation: cytochrome o ubiquinol oxidase subunit I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 670 transmembrane" amino acids 16 to 36 (21 residues), see Phobius details amino acids 57 to 77 (21 residues), see Phobius details amino acids 103 to 127 (25 residues), see Phobius details amino acids 144 to 169 (26 residues), see Phobius details amino acids 189 to 213 (25 residues), see Phobius details amino acids 229 to 254 (26 residues), see Phobius details amino acids 275 to 298 (24 residues), see Phobius details amino acids 315 to 334 (20 residues), see Phobius details amino acids 346 to 368 (23 residues), see Phobius details amino acids 380 to 403 (24 residues), see Phobius details amino acids 416 to 440 (25 residues), see Phobius details amino acids 455 to 475 (21 residues), see Phobius details amino acids 494 to 519 (26 residues), see Phobius details amino acids 589 to 606 (18 residues), see Phobius details amino acids 612 to 632 (21 residues), see Phobius details TIGR02843: cytochrome o ubiquinol oxidase, subunit I" amino acids 2 to 649 (648 residues), 1136.4 bits, see alignment E=0 PF00115: COX1" amino acids 56 to 502 (447 residues), 495.3 bits, see alignment E=8.1e-153

Best Hits

Swiss-Prot: 69% identical to QOX1_ACEAC: Ubiquinol oxidase subunit 1 (cyaA) from Acetobacter aceti

KEGG orthology group: K02298, cytochrome o ubiquinol oxidase subunit I [EC: 1.10.3.-] (inferred from 95% identity to bph:Bphy_3648)

MetaCyc: 66% identical to cytochrome bo terminal oxidase subunit I (Pseudomonas putida KT2440)
RXN0-5268 [EC: 7.1.1.3]

Predicted SEED Role

"Cytochrome O ubiquinol oxidase subunit I (EC 1.10.3.-)" in subsystem Terminal cytochrome O ubiquinol oxidase or Terminal cytochrome oxidases (EC 1.10.3.-)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 7.1.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (670 amino acids)

>QEN71_RS13335 cytochrome o ubiquinol oxidase subunit I (Paraburkholderia sabiae LMG 24235)
MFGKLTLEAIPFDQPIIMGAGALMGLIVLAVAVFLTRAHKWRWLWTEWLTSVDHKRIGVM
YIVVAVLMLLRGFADAVMMRLQLALASGGAAGYLPPHHYDQIFTAHGVIMIFFMAMALMV
GLFNIVVPLQIGARDVAFPFLNSLSFWMTAISAILMNISLVIGEFAQVGWLAYPPLSELQ
FSPGVGVDYYIWALELSGVGTLITAINFFVTIVKMRAPGMSLMKMPVFTWTALCSNVLIM
ATFPILTIALALLGFDRYADMHFFTNEAGGNAMLYLNLIWAWGHPEVYILVLPAFGIYSE
VISTFAKKPLFGYKTMVYASCAIMVLAFLVWAHHFFTMGSGADVNAFFGIATMIIAIPTG
VKIFNWLFTIYRGRLEITAPVLWTIGFMITFTIGGMTGVMLAIPGADFVLHNSLFLVAHF
HNTIIGGVVFGYLAGVSYWFPKVFGFKLNEKLGKAAFWFWFTGFYVAFMPLYVLGFMGAT
RRLNHYDDPAWHPYMIVAAIGVALIAIGVVCQVTQFVVSIINRNKPEYRDVTGDPWGGRT
LEWSISSPPPVYNFATIPVVEELDAFAHMKETGRGLGVQAKYEAIHMPSNTGAGFFIGVF
SLAFGFAAVWHIWWLAIVSLVAIAATVIGRSFGRDDGYYIPSDVVRTTENKGRTPLPQRV
DVSPELAEVE