Protein Info for QEN71_RS13015 in Paraburkholderia sabiae LMG 24235

Annotation: fructose bisphosphate aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 PF00274: Glycolytic" amino acids 55 to 213 (159 residues), 30.1 bits, see alignment E=1.1e-11

Best Hits

Swiss-Prot: 58% identical to ALF1_STACT: Fructose-bisphosphate aldolase class 1 (fda) from Staphylococcus carnosus (strain TM300)

KEGG orthology group: K01623, fructose-bisphosphate aldolase, class I [EC: 4.1.2.13] (inferred from 96% identity to bph:Bphy_3578)

MetaCyc: 56% identical to class I fructose-bisphosphate aldolase/sedoheptulose-1,7-bisphosphate aldolase monomer (Synechocystis sp. PCC 6803)
Fructose-bisphosphate aldolase. [EC: 4.1.2.13]; 4.1.2.13 [EC: 4.1.2.13]

Predicted SEED Role

"Fructose-bisphosphate aldolase class I (EC 4.1.2.13)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis (EC 4.1.2.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.2.13

Use Curated BLAST to search for 4.1.2.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (298 amino acids)

>QEN71_RS13015 fructose bisphosphate aldolase (Paraburkholderia sabiae LMG 24235)
MANEKMLAQISEKAGFIAALDQSGGSTPGALRQYGIPDDAYSGDAEMFKLIHEMRVRIIT
APAFTGEKVIAAILFEATMDGQAQGKPVPAFLWEDRGVVPFLKVDKGLEAESDGVRLMKP
IPGLDALVARAVKLGIFGTKMRSVIEQNSPAGIAAVVKQQFEYGAQIDAGGLMPILEPEV
SIKTPDKAGAEKALRDEILKGLDALPADKQVMLKLTIPDVADFYKPLIDHPRVLRVVALS
GGYTRTEACKLLAKNHGMIASFSRALINDLKKPMSDSEFDAKLAEAIDEIYDASAVKV