Protein Info for QEN71_RS12990 in Paraburkholderia sabiae LMG 24235

Annotation: SulP family inorganic anion transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 497 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 41 to 58 (18 residues), see Phobius details amino acids 63 to 80 (18 residues), see Phobius details amino acids 86 to 105 (20 residues), see Phobius details amino acids 116 to 134 (19 residues), see Phobius details amino acids 149 to 170 (22 residues), see Phobius details amino acids 177 to 196 (20 residues), see Phobius details amino acids 228 to 248 (21 residues), see Phobius details amino acids 267 to 290 (24 residues), see Phobius details amino acids 301 to 321 (21 residues), see Phobius details amino acids 326 to 347 (22 residues), see Phobius details amino acids 359 to 389 (31 residues), see Phobius details PF00916: Sulfate_transp" amino acids 11 to 363 (353 residues), 196 bits, see alignment E=1.4e-61 PF01740: STAS" amino acids 412 to 488 (77 residues), 34.6 bits, see alignment E=2.1e-12 PF13466: STAS_2" amino acids 416 to 485 (70 residues), 32.9 bits, see alignment E=8.7e-12

Best Hits

KEGG orthology group: None (inferred from 80% identity to bpy:Bphyt_4452)

Predicted SEED Role

"Sulfate permease" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (497 amino acids)

>QEN71_RS12990 SulP family inorganic anion transporter (Paraburkholderia sabiae LMG 24235)
MQDRRFNFSSLRGDVLAGLTSSFALVPECIAFALVAHLNPLMGLYGAFFICTITALFGGR
PGMISGAAGSMAVVIVALVVQHGPQYLFATVVLGGVLMMLFGALRLGKLIRMVPHPVMLG
FVNGLAIIIAMAQLEHFRQATPQGTAWLHGQALWLMCGLVALTIAIVYGLPRLTKAVPPA
LAAIVGIGVLSELLHLPTRTLGDMAHIAGGLPQFSVPGVPFDLDTLRIVFPYAALMSMVG
LLETLLTFNLTDEITESRGQPNRECIALGAANIVSGLFGAMGGCAMIGQTVINLSSGGRT
RVSGVTSGVMILLFILFLSPLIERIPLAALVGVMFVVAQQTFSWGSLRALKKVPRSDALV
IVAVTAITVFTDLATAVLCGIVISALSFAWQHANEIHRETTDGADGETTHAPRGTLFFAS
TTHFHALFEPHNDPADVTLDCRHLHFADHSAIAALETLHERYAKLGKRLRLTNLSTRNRR
LLQRADASVVMDTTSAA