Protein Info for QEN71_RS12910 in Paraburkholderia sabiae LMG 24235

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 transmembrane" amino acids 15 to 41 (27 residues), see Phobius details amino acids 51 to 70 (20 residues), see Phobius details amino acids 81 to 100 (20 residues), see Phobius details amino acids 102 to 122 (21 residues), see Phobius details amino acids 141 to 160 (20 residues), see Phobius details amino acids 166 to 185 (20 residues), see Phobius details amino acids 207 to 231 (25 residues), see Phobius details amino acids 243 to 264 (22 residues), see Phobius details amino acids 272 to 293 (22 residues), see Phobius details amino acids 299 to 323 (25 residues), see Phobius details amino acids 335 to 353 (19 residues), see Phobius details amino acids 365 to 383 (19 residues), see Phobius details PF07690: MFS_1" amino acids 22 to 189 (168 residues), 46.7 bits, see alignment E=1.1e-16 amino acids 217 to 379 (163 residues), 43.9 bits, see alignment E=7.8e-16

Best Hits

KEGG orthology group: None (inferred from 66% identity to bxe:Bxe_B0947)

Predicted SEED Role

"Transporter, MFS superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (400 amino acids)

>QEN71_RS12910 MFS transporter (Paraburkholderia sabiae LMG 24235)
MNTPGSDAIRTRWSAVAALTAVSTLSQIGQFGIGFMVLPVWLAHQGLDAPSAGLFAAAQW
TGMFIGLLFAPRLMERMGSKLTVSLGLLSSLVAYGTLGALTWPAWILPGMLTGLGIGLRW
IANETWLYSLVPADKSGKVVGIHEALIASAGVLAPALAVLCGVSGTLVFLAGSLLTAAAA
IPLWLTRSSARQTVLVIPAVQGKRVELGPIVCLGLVTIAVGGIGDGALYGLFPLFADSRG
LTAAQTATMLACFGIGGMVLQFPVGWLADRFGLAATVIVCALASTASIVAFSFAPCASFA
YIAAALFLGGMNSAYITLGMYAAACSDKQAITRNMRVLSLAFTACSIAGPLFAGPAMKAL
GNDLLMWQLAIMSGALMIYTVGMREGHRQAQQRMPSPSST