Protein Info for QEN71_RS12860 in Paraburkholderia sabiae LMG 24235

Annotation: enoyl-CoA hydratase/isomerase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00378: ECH_1
  • amino acids 10 to 260 (251 residues), 191.6 bits, E=1.6e-60
• PF16113: ECH_2
  • amino acids 15 to 238 (224 residues), 105.3 bits, E=5e-34

Best Hits

KEGG orthology group: K13766, methylglutaconyl-CoA hydratase [EC: 4.2.1.18] (inferred from 92% identity to bph:Bphy_3560)

MetaCyc: 42% identical to 3-methylglutaconyl-CoA hydratase (Pseudomonas putida)
Methylglutaconyl-CoA hydratase. [EC: 4.2.1.18]

Predicted SEED Role

"Methylglutaconyl-CoA hydratase (EC 4.2.1.18)" in subsystem Benzoate transport and degradation cluster or HMG CoA Synthesis or Leucine Degradation and HMG-CoA Metabolism (EC 4.2.1.18)

MetaCyc Pathways

• L-leucine degradation I (5/6 steps found)
• ferrichrome A biosynthesis (1/5 steps found)

KEGG Metabolic Maps

• Valine, leucine and isoleucine degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.18

Protein Sequence (261 amino acids)

>QEN71_RS12860 enoyl-CoA hydratase/isomerase family protein (Paraburkholderia sabiae LMG 24235)
MQYDNLTLTFDNSVATVTLNRPDVRNAFNEAMIAEVTSVFKALDERDDVRAVVLAANGKA
FCAGADLNWMKKMAGYSDDENRADAMRLADMLASIYRCNKPVIARVNGDAYAGGMGLLSA
CDIVVAVDSAKFCLSEARLGLIPATIAPYVIRALGEQASRRYFMTAEAFDCATAQRLGFV
AECVSADKLDETVQQLAATLCANGPQAVKACKQLVHDIAGREISAALIEDTAVRIAKTRA
GAEGREGVASFLEKRSPSWRA