Protein Info for QEN71_RS12370 in Paraburkholderia sabiae LMG 24235

Annotation: (2Fe-2S)-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00111: Fer2
  • amino acids 35 to 88 (54 residues), 40.7 bits, E=2.8e-14
• PF13085: Fer2_3
  • amino acids 41 to 103 (63 residues), 27.2 bits, E=5e-10
• PF01799: Fer2_2
  • amino acids 102 to 175 (74 residues), 107.8 bits, E=3.7e-35

Best Hits

Swiss-Prot: 48% identical to CUTC_SULAC: Glyceraldehyde dehydrogenase small chain (cutC) from Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)

KEGG orthology group: K13483, xanthine dehydrogenase YagT iron-sulfur-binding subunit (inferred from 91% identity to bph:Bphy_5132)

MetaCyc: 49% identical to glycolaldehyde oxidoreductase small subunit (Saccharolobus solfataricus P2)
1.2.99.-

Predicted SEED Role

"Periplasmic aromatic aldehyde oxidoreductase, iron-sulfur subunit YagT"

MetaCyc Pathways

• L-arabinose degradation IV (6/8 steps found)
• D-xylose degradation IV (4/7 steps found)
• superpathway of pentose and pentitol degradation (23/42 steps found)

Protein Sequence (181 amino acids)

>QEN71_RS12370 (2Fe-2S)-binding protein (Paraburkholderia sabiae LMG 24235)
MPHTIARPQVTPQESRERSGSPHPTPGVTIPVELNVNGTSYALSLDPRTTLLDALREHLH
LTGTKKGCDHGQCGACTVHVNGRRVNACLSLAATHADDTITTIEGIGEPDALHPMQAAFV
ECDGYQCGYCTAGQIMSAVALLGETIGPDDADVREAMSGNLCRCGAYQNIVTAIQSVRGK
R