Protein Info for QEN71_RS12185 in Paraburkholderia sabiae LMG 24235

Annotation: D-2-hydroxyacid dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 PF00389: 2-Hacid_dh" amino acids 28 to 322 (295 residues), 94.8 bits, see alignment E=3.6e-31 PF02826: 2-Hacid_dh_C" amino acids 111 to 291 (181 residues), 168.2 bits, see alignment E=1.3e-53

Best Hits

Swiss-Prot: 47% identical to Y1556_HAEIN: Putative 2-hydroxyacid dehydrogenase HI_1556 (HI_1556) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K00018, glycerate dehydrogenase [EC: 1.1.1.29] (inferred from 66% identity to reh:H16_B0611)

Predicted SEED Role

"Hydroxypyruvate reductase (EC 1.1.1.81)" in subsystem Glycolate, glyoxylate interconversions or Photorespiration (oxidative C2 cycle) (EC 1.1.1.81)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.29, 1.1.1.81

Use Curated BLAST to search for 1.1.1.29 or 1.1.1.81

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (327 amino acids)

>QEN71_RS12185 D-2-hydroxyacid dehydrogenase (Paraburkholderia sabiae LMG 24235)
MSSSCLRVVFLDKATIPPTTNLKELPFGHTLELHDSTKPDQVGERIRNADVVITNKVKLG
GDALAQAKNLKLIAIAATGSDNVDLSACNERGITVCNIRNYAVNTVPEHTFALIFALRRS
LAPYRTAVQAGRWRESDQFCFFDYPISDVAGSTLGVIGDGALGRATAEIGKALGMKVLFS
AFKGRDDMGVLYTPFERVLAESDIITLHCPLVDETRNLIDDAEFVQMKRRPLLINTARGG
LVNEGALVRALQDGLISGAGFDVVTEEPLSSDNPLNEILNHPGFILTPHVAWASKEAIQS
LADQLMDNVTAYVQGSPRNVVNAPAGN