Protein Info for QEN71_RS12180 in Paraburkholderia sabiae LMG 24235

Annotation: dicarboxylate/amino acid:cation symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 transmembrane" amino acids 24 to 43 (20 residues), see Phobius details amino acids 63 to 81 (19 residues), see Phobius details amino acids 94 to 115 (22 residues), see Phobius details amino acids 166 to 183 (18 residues), see Phobius details amino acids 205 to 228 (24 residues), see Phobius details amino acids 242 to 269 (28 residues), see Phobius details amino acids 307 to 334 (28 residues), see Phobius details amino acids 338 to 356 (19 residues), see Phobius details amino acids 366 to 392 (27 residues), see Phobius details amino acids 398 to 417 (20 residues), see Phobius details PF00375: SDF" amino acids 25 to 417 (393 residues), 365.2 bits, see alignment E=2.2e-113

Best Hits

Swiss-Prot: 62% identical to DCTA_PSEF5: C4-dicarboxylate transport protein (dctA) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K11103, aerobic C4-dicarboxylate transport protein (inferred from 61% identity to pfv:Psefu_2932)

MetaCyc: 60% identical to C4 dicarboxylate/orotate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-121; TRANS-RXN-121A; TRANS-RXN-121C; TRANS-RXN-122A; TRANS-RXN0-451; TRANS-RXN0-517; TRANS-RXN0-553

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (437 amino acids)

>QEN71_RS12180 dicarboxylate/amino acid:cation symporter (Paraburkholderia sabiae LMG 24235)
MSIATEASVEPQAKPRARKRWFQHLYIQVLIAVVLGILLGHFYPSAGEAMKPLGDNFLKL
IKLMIAPLIFCTVVHGIASMNDIKSVGRVGVKSLIYFELMTTLALAIGLIAVNIMKPGSG
MHIDPKTLDVSAIAAYTKAAHDQSVVGFLSHIIPSTVFGAFAEGDILQVLFVSVIFAFAL
QMLGERGKPLLSVIDAGANTFFNMVRIVMYVSPLGAFGAIAFTIGKYGVISLGSYGQLLL
TYYLTGFVFVFVILGAVCRLAGFSLIAFLRYIREELLLVLGTSSSESALPRLMAKLERLG
CEKSVVGLVVPAGYSFNLDGSCINMTVLAIFIAQATDSTLSIGHQITLLLVLLLTSKGAA
SVSGGAFIVLAATLSSVPGIPVAGLVLVLGIYRFISEGGALINVIGNGIATIVVAKWERA
LDRSTFKAQLARGPRDD