Protein Info for QEN71_RS12150 in Paraburkholderia sabiae LMG 24235

Annotation: L-lactate permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 591 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 40 to 57 (18 residues), see Phobius details amino acids 69 to 90 (22 residues), see Phobius details amino acids 118 to 148 (31 residues), see Phobius details amino acids 155 to 178 (24 residues), see Phobius details amino acids 196 to 213 (18 residues), see Phobius details amino acids 223 to 244 (22 residues), see Phobius details amino acids 251 to 268 (18 residues), see Phobius details amino acids 354 to 374 (21 residues), see Phobius details amino acids 407 to 430 (24 residues), see Phobius details amino acids 443 to 461 (19 residues), see Phobius details amino acids 467 to 492 (26 residues), see Phobius details amino acids 563 to 582 (20 residues), see Phobius details TIGR00795: transporter, lactate permease (LctP) family" amino acids 14 to 581 (568 residues), 389.4 bits, see alignment E=1.5e-120 PF02652: Lactate_perm" amino acids 16 to 581 (566 residues), 409.1 bits, see alignment E=1.6e-126

Best Hits

Predicted SEED Role

"L-lactate permease" in subsystem Lactate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (591 amino acids)

>QEN71_RS12150 L-lactate permease (Paraburkholderia sabiae LMG 24235)
MYHQIYNPLGQSIGASAAAAALPLVVLFVLLGIFKVQARWAALCALLCSLAVAVFVYQMP
YVQTASTAALGASTGFFPIIWIGINAIWVFKLTQTSGHDVVLRNCLSQVSPDTRVQAVLI
AFCFGGLLESLAGGGAPVAICAVMLIAVGLDPVKAAAICLLADTSPVAFGSLGLPISLLS
KVTSLPVQSLSMMVGRQTPLLAMFVPLILIVVADGKRGVKEVWPLALLAGAVFASAQCIG
SAFLPLELVDIVSALSATGAALLFLKVWQPRSTSQVESKGQLASAKTGEMTPSWAIPSAA
GVPAMAASAAGVSVESRLNREEATFGRTGSGNAGGAGVTAAKYPTYSALEIFRALAPYLV
IIGLVALMQVKWIGHAFGSATSSFDWPFLDIMTASGKHVSTKAKFEWLASAGSIVLLAGL
IVGPILGLSFKQSLSAYKATLHQLRWAVFTVCCVVGVAYVMNYSGQVITLGIFAANAGPA
FAFVSPVLGWIATALTGSDTSANALFGVLQTTTAQHTGLSPILLAAANSSGGVVGKAISP
QNLAIAAVAVGMAGKEGLLFRRVFGWTLLMIVGMSILVYLQSTNLLGWMVP