Protein Info for QEN71_RS11940 in Paraburkholderia sabiae LMG 24235

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 61 to 81 (21 residues), see Phobius details amino acids 93 to 114 (22 residues), see Phobius details amino acids 121 to 147 (27 residues), see Phobius details amino acids 159 to 178 (20 residues), see Phobius details amino acids 184 to 203 (20 residues), see Phobius details amino acids 231 to 252 (22 residues), see Phobius details amino acids 264 to 283 (20 residues), see Phobius details amino acids 294 to 313 (20 residues), see Phobius details amino acids 319 to 339 (21 residues), see Phobius details amino acids 350 to 371 (22 residues), see Phobius details amino acids 408 to 431 (24 residues), see Phobius details PF07690: MFS_1" amino acids 21 to 362 (342 residues), 80.3 bits, see alignment E=6.9e-27

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (451 amino acids)

>QEN71_RS11940 MFS transporter (Paraburkholderia sabiae LMG 24235)
MDTLDHNKTLESLKGVPVSRIFVAAFITQFAMGMIMLLRINAATAIKSQFFDAVDPLTSG
AHIGEILGVLFLGFAIANFVMSPFVDALGMRRVHIAGILVFLAGTALLCVARPTAESAYA
LLWGGSLLQGLAWGALESVLNPLVVSIYPTRKVAKLNQFHGAFALGVLVAAPLCMAVERY
DLGWRLQLCTVFLPCMVAVMMVLRLKYPLSERVVHGVSFQQMLKHTLNRPLFYFCLVAMF
LTAATELVPSNWIDLTLTKVVGMQGFWLVAFIYTISFVVRLFAGPLSQRIGSAGLLVFAS
ALALAGLVCLSQATTPTSGLLAALLFGCGTSLMWPTTLASASERFPAGGSFAIGTIASAG
MLSTYVMMPIFGKMFDVAKVNAAGGAAAFKSLAAGSAAFDKSMAVAAMTIFKSASVMPVI
TLVFFACLWFADNRRRQRRTSFPELRGLSRS