Protein Info for QEN71_RS11785 in Paraburkholderia sabiae LMG 24235

Annotation: ABC transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 transmembrane" amino acids 29 to 50 (22 residues), see Phobius details amino acids 86 to 113 (28 residues), see Phobius details amino acids 121 to 139 (19 residues), see Phobius details amino acids 145 to 164 (20 residues), see Phobius details amino acids 185 to 205 (21 residues), see Phobius details amino acids 209 to 229 (21 residues), see Phobius details amino acids 240 to 261 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 97 to 266 (170 residues), 104.8 bits, see alignment E=2.4e-34

Best Hits

Swiss-Prot: 50% identical to SSUC_ECOLI: Putative aliphatic sulfonates transport permease protein SsuC (ssuC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 82% identity to bxe:Bxe_B2638)

MetaCyc: 50% identical to aliphatic sulfonate ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-56-RXN [EC: 7.6.2.14]

Predicted SEED Role

"Alkanesulfonates transport system permease protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (279 amino acids)

>QEN71_RS11785 ABC transporter permease subunit (Paraburkholderia sabiae LMG 24235)
MAELTSLRNSQVSSTRAHAGVSKSTLYKWLSWAVPAAIVVLWEAAARLGWIEPQVMPAPS
SVLDTAVNLARSGDLFVHLGVSLLRAVVGFVIGGTIGLVLGILTGFSPLALALFDRSIQM
VRAVPFLAMLPLVIVWFGVGEPAKIFLVALAVLFPIYINTMLGIRQIDPKLMELAKVVGL
SWRAIVRRIILPGAMPSILTGVRYALAHAWLALVVAETLATTEGIGFLAMDAREFLQTNV
ILLTMIIYAFIGVVADALVRLLEARLLSWHANYAKGEQK