Protein Info for QEN71_RS11565 in Paraburkholderia sabiae LMG 24235

Annotation: dicarboxylate/amino acid:cation symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 49 to 72 (24 residues), see Phobius details amino acids 85 to 106 (22 residues), see Phobius details amino acids 154 to 172 (19 residues), see Phobius details amino acids 199 to 224 (26 residues), see Phobius details amino acids 230 to 250 (21 residues), see Phobius details amino acids 299 to 321 (23 residues), see Phobius details amino acids 326 to 344 (19 residues), see Phobius details amino acids 355 to 377 (23 residues), see Phobius details PF00375: SDF" amino acids 9 to 404 (396 residues), 371.1 bits, see alignment E=3.5e-115

Best Hits

KEGG orthology group: None (inferred from 89% identity to bcj:BCAS0241)

Predicted SEED Role

"C4-dicarboxylate transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (435 amino acids)

>QEN71_RS11565 dicarboxylate/amino acid:cation symporter (Paraburkholderia sabiae LMG 24235)
MNRKNAAAIWILIAMLVGIAIGYMIYTSFPDRKSATEIAGYISLVSDVFLRLIKMVIGPL
VFSTLVVGIAHMGDAASVGRVFAKALGWFITASLISLLLGLLMSNLLKPGENLGLPLPDI
GASANLATAKFTLKDFVGHMVPRSFAESMANNEILQIVVFSMFFGIALAALGEKGKVLVA
AIDQLSHVMLKITGYVMKLAPLAVLAAMAATVAVNGLTILLKFAVFMGDFYLSLFLLWAV
LTAAGFLFLGPRVFKLLALIKEAFMLSFATASSEAAYPKILDALDRFGVKRKISSFVMPM
GYSFNLDGSMMYCTFATLFIAQAYNMHLSLGTQLTMLLILMLTSKGMAGVPRASLVVIAA
TLNQFGIPEAGLLLILGVDTFLDMGRSATNAVGNSIASAVVAKWEGELMSEAEAQANAAR
IDAELDATIAHPAES